DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and Hars

DIOPT Version :8

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001020585.1 Gene:Hars / 307492 RGDID:1310695 Length:508 Species:Rattus norvegicus

Alignment Length:559 Identity:329/560 (59%)
Similarity:398/560 (71%) Gaps:58/560 (10%)


  Fly     1 MSDTREQILEQIKVQGDLVRQLKAAKESKEKTAPSGGGRVSSSGVPAQRQQQQQPQKQQQAQVQQ 65
            |:| |..:.|.:::||..||.||..|.|.|                                   
  Rat     1 MAD-RAALEELVRLQGAHVRGLKEQKASAE----------------------------------- 29

  Fly    66 QQHEQLHQIDEEVARLLALKATLGGDAAPTNQKFTLKTPKGTRDYGPQQMTLRQGVLDKIVQVFK 130
                   ||:|||.:||.|||.||.|..  .|||.||||||||||.|:||.:|:.|.|.|::.||
  Rat    30 -------QIEEEVTKLLKLKAQLGHDEG--KQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFK 85

  Fly   131 RHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSIKRY 195
            |||.|.||||||||||.|||||||||||||||||||||:||:|||||||.||||||||:::||||
  Rat    86 RHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRY 150

  Fly   196 HIAKVYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDIGDYVIKLNHRQ 260
            ||||||||||||||:|||||||||||||||.:|||:|||||:||:.|||.:|.||::.:|:|.|:
  Rat   151 HIAKVYRRDNPAMTRGRYREFYQCDFDIAGQFDPMIPDAECLKIMCEILSSLQIGNFQVKVNDRR 215

  Fly   261 LLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDEKGLDEAAADRIGEYVRLSGGAELV 325
            :|||||..||||...||||||:||||||..|.:|:.|||.||||....|||||:||:..||..||
  Rat   216 ILDGMFAVCGVPDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLV 280

  Fly   326 EQLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDKRVSFDLSLARGLDYYTGVIYEGVLKGESA 390
            ||||.:.||.....||:||..:|.|.:|.::||:|.::|||||||||||||||||||.||     
  Rat   281 EQLLQDPKLSQNKQAVEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVL----- 340

  Fly   391 TVASPAKTSQQNGEQANEPATVGSVAGGGRYDNLVGMFDPRGKAVPCVGVSIGVERIFSVLEARA 455
                 .:...|.||   ||..|||:|.|||||.|||||||:|:.|||||:|||||||||::|.:.
  Rat   341 -----LQMPTQAGE---EPLGVGSIAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQKL 397

  Fly   456 AASGLKLRTSDVEVYVASAHKGLHEQRLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHCEEHQIPL 520
            .||..|:||::.:|.||||.|.|.|:|||:::.|||||:|||..||.|||||.|||:|||..|||
  Rat   398 EASEEKVRTTETQVLVASAQKKLLEERLKLISELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPL 462

  Fly   521 VVVLGDAELAQGLVKLREVTTREETNVKLEDLAAEIRRR 559
            |.::|:.||..|::|||.||:|||.:|:.|||..|||||
  Rat   463 VAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIRRR 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248 23/86 (27%)
HisS 98..561 CDD:223202 302/463 (65%)
HisRS-like_core 114..452 CDD:238396 226/338 (67%)
HisRS_anticodon 467..557 CDD:238436 54/90 (60%)
HarsNP_001020585.1 HisRS_RNA 5..49 CDD:238474 23/86 (27%)
HisS 56..501 CDD:223202 299/458 (65%)
HisRS-like_core 69..394 CDD:238396 226/338 (67%)
HisRS_anticodon 408..499 CDD:238436 54/91 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175321883
eggNOG 1 0.900 E1_COG0124
Hieranoid 1 1.000
Homologene 1 1.000 H1592
Inparanoid 1 1.050 624 1.000 Inparanoid score I806
OMA 1 1.010
OrthoDB 1 1.010 D1065556at2759
OrthoFinder 1 1.000 FOG0002150
OrthoInspector 1 1.000 T618295
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11476
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.