DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and Hars

DIOPT Version :8

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_032240.3 Gene:Hars / 15115 MGIID:108087 Length:509 Species:Mus musculus

Alignment Length:559 Identity:329/560 (59%)
Similarity:397/560 (71%) Gaps:58/560 (10%)


  Fly     1 MSDTREQILEQIKVQGDLVRQLKAAKESKEKTAPSGGGRVSSSGVPAQRQQQQQPQKQQQAQVQQ 65
            |:| |..:.|.:::||..||.||..|.|.|                                   
Mouse     1 MAD-RAALEELVRLQGAHVRGLKEQKASAE----------------------------------- 29

  Fly    66 QQHEQLHQIDEEVARLLALKATLGGDAAPTNQKFTLKTPKGTRDYGPQQMTLRQGVLDKIVQVFK 130
                   ||:|||.:||.|||.||.|..  .|||.||||||||||.|:||.:|:.|.|.|::.||
Mouse    30 -------QIEEEVTKLLKLKAQLGQDEG--KQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFK 85

  Fly   131 RHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSIKRY 195
            |||.|.||||||||||.|||||||||||||||||||||:||:|||||||.||||||||:::||||
Mouse    86 RHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRY 150

  Fly   196 HIAKVYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDIGDYVIKLNHRQ 260
            ||||||||||||||:|||||||||||||||.:|||:|||||:||:.|||.:|.||::::|:|.|:
Mouse   151 HIAKVYRRDNPAMTRGRYREFYQCDFDIAGQFDPMIPDAECLKIMCEILSSLQIGNFLVKVNDRR 215

  Fly   261 LLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDEKGLDEAAADRIGEYVRLSGGAELV 325
            :|||||..||||...||||||:||||||..|.:|:.|||.||||....|||||:||:..||..||
Mouse   216 ILDGMFAVCGVPDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLV 280

  Fly   326 EQLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDKRVSFDLSLARGLDYYTGVIYEGVLKGESA 390
            ||||.:.||.....||:||..:|.|.:|..:||:|.::|||||||||||||||||||.||     
Mouse   281 EQLLQDPKLSQNKQAVEGLGDLKLLFEYLILFGIDDKISFDLSLARGLDYYTGVIYEAVL----- 340

  Fly   391 TVASPAKTSQQNGEQANEPATVGSVAGGGRYDNLVGMFDPRGKAVPCVGVSIGVERIFSVLEARA 455
                 .:...|.||   ||..|||:|.|||||.|||||||:|:.|||||:|||||||||::|.|.
Mouse   341 -----LQMPTQAGE---EPLGVGSIAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRL 397

  Fly   456 AASGLKLRTSDVEVYVASAHKGLHEQRLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHCEEHQIPL 520
            .||..|:||::.:|.||||.|.|.|:|||:::.|||||:|||..||.|||||.|||:|||..|||
Mouse   398 EASEEKVRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPL 462

  Fly   521 VVVLGDAELAQGLVKLREVTTREETNVKLEDLAAEIRRR 559
            |.::|:.||..|::|||.|.:|||.:|:.|||..|||||
Mouse   463 VAIIGEQELKDGVIKLRSVASREEVDVRREDLVEEIRRR 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248 23/86 (27%)
HisS 98..561 CDD:223202 302/463 (65%)
HisRS-like_core 114..452 CDD:238396 226/338 (67%)
HisRS_anticodon 467..557 CDD:238436 53/90 (59%)
HarsNP_032240.3 HisRS_RNA 5..49 CDD:238474 23/86 (27%)
HisS 56..501 CDD:223202 299/458 (65%)
HisRS-like_core 69..394 CDD:238396 226/338 (67%)
L-histidine binding. {ECO:0000250|UniProtKB:P12081} 130..132 2/2 (100%)
L-histidine binding. {ECO:0000250|UniProtKB:P12081} 330..331 1/1 (100%)
HisRS_anticodon 408..499 CDD:238436 53/91 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175314415
eggNOG 1 0.900 E1_COG0124
Hieranoid 1 1.000
Homologene 1 1.000 H1592
Inparanoid 1 1.050 623 1.000 Inparanoid score I863
Isobase 1 0.950 0 Normalized mean entropy S444
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002150
OrthoInspector 1 1.000 T616172
orthoMCL 1 0.900 OOG5_126806
Panther 1 1.100 LDO PTHR11476
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1442
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.