DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HisRS and AgaP_AGAP012368

DIOPT Version :9

Sequence 1:NP_573305.2 Gene:HisRS / 32841 FlyBaseID:FBgn0027087 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_320188.4 Gene:AgaP_AGAP012368 / 1280343 VectorBaseID:AGAP012368 Length:1484 Species:Anopheles gambiae


Alignment Length:475 Identity:111/475 - (23%)
Similarity:191/475 - (40%) Gaps:134/475 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KIVQVFKRHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNK 188
            |:|.:|::||...:.||   |....|.::...|..: .|....|.::::..||.||..|::|:|.
Mosquito   883 KLVALFRKHGAIEVVTP---LLTPYTKQHAARSNTV-KLMTHSGSVVTLPDDLRVPFLRHIALNG 943

  Fly   189 ISSIKRYHIAKVYRRD-----NPAMTKGRYREFYQCDFDI-AGTYDPMLPDAECVKIVSEILDTL 247
            |..|:||.|.:|||..     :|       ::.|:|.||| ..:...::.|||.:.|.::::..|
Mosquito   944 IKHIRRYSIGRVYREKKVFNFHP-------KQVYECAFDIVTPSRGHLITDAELLAIATDVMREL 1001

  Fly   248 DI---GDYVIKLNHRQLLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDEK------- 302
            ::   .:...:|||..||..:...|.||.|.:|.:...|            .|.:|||       
Mosquito  1002 NLLQGRNVFFRLNHIGLLRAILMHCNVPMDKYRELFEMV------------AEFLDEKISKFQLS 1054

  Fly   303 ----GLDEAAADRIG------------EYVRLSGGAELVEQLL--ANEKLKAVPNAVKGLEGMKQ 349
                .|...:|.:|.            ..|.|.||: :::.::  ..|.......||:.||.:..
Mosquito  1055 SLINSLIGGSAAKINVSFLCDALQLELSSVGLLGGS-ILKSIIRGKGEAASLAKVAVRELETVVT 1118

  Fly   350 LLKYCSIFGLDKRVSFDLSLARGL--DYYT----GVIYEGVLKGESATVASPAKTSQQNGEQANE 408
            |.:       :..|...|::..||  :|..    |::::  |.||       .|..::|      
Mosquito  1119 LAQ-------NMGVQCPLNVCPGLPVNYERAKTGGIVWQ--LLGE-------LKPKRKN------ 1161

  Fly   409 PATVGSVAGGGRYDNLVGMFDP----RGKAVPCVGVSIGVERIF---SVLEARAAASGLKLRTSD 466
            |.|  ::|.|||||..:..|..    .|..||.|.:| |....|   .::.|.|..:|.:    .
Mosquito  1162 PLT--TIAVGGRYDGKLAEFQKSGINNGLQVPKVDLS-GAGFSFLLDKLVNAIAPTAGYE----P 1219

  Fly   467 VEVYV-ASAHKGLHEQRLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHC-------------EEHQ 517
            :||.: .:..:...::..:.|..||...:|.                |             :|..
Mosquito  1220 IEVMICVTGSRPQPKEVAQTLRPLWSNSIKT----------------CVVETSAGAVDDLGKEAG 1268

  Fly   518 IPLVVVLGDAELAQGLVKLR 537
            ..:||:|||.    |.:::|
Mosquito  1269 ATVVVLLGDG----GEMRVR 1284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HisRSNP_573305.2 S15_NS1_EPRS_RNA-bind 6..92 CDD:294248
HisS 98..561 CDD:223202 111/475 (23%)
HisRS-like_core 114..452 CDD:238396 93/374 (25%)
HisRS_anticodon 467..557 CDD:238436 15/85 (18%)
AgaP_AGAP012368XP_320188.4 RWD 11..123 CDD:283440
DUF755 125..205 CDD:253225
PKc_like 244..450 CDD:304357
PKc_like <667..815 CDD:304357
HisS 873..1309 CDD:223202 111/475 (23%)
class_II_aaRS-like_core 876..1211 CDD:294192 93/376 (25%)
DUF2779 <1435..1459 CDD:287984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.