DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15046 and CG10764

DIOPT Version :10

Sequence 1:NP_573298.1 Gene:CG15046 / 32833 FlyBaseID:FBgn0030927 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:196 Identity:35/196 - (17%)
Similarity:72/196 - (36%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 TTC-REGTHEEIICCPLNLPLQPRVHTGLRLGVQGDSSEGKAAEDP--LELAAIARADRLLPHYR 262
            |.| .|..|.:.:..|..:..:|::            |.|..|.:|  :.:|||           
  Fly    14 TLCVTENEHFKFLETPCGISTRPKI------------SGGDDAAEPNSIWMAAI----------- 55

  Fly   263 HLASLAHPNAAFDGHLHHCAALVLTPQLLVSAAGCERPSHAVF---GVADLRD---------VDA 315
                       |:.....|...::..:.::|||.|....:.::   |..::.:         |..
  Fly    56 -----------FNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTVINVFV 109

  Fly   316 DEDYLADIVRLVQFQKDLSLIRLQDPLRLGSQTSANVSVAPICTQFELT---RLQRSGSLVAVGW 377
            ..|::|.     :::.|:.|::|.:.:      ...|.|.|||...:..   .:::..:..|:||
  Fly   110 HHDFIAS-----EYRNDIGLLQLSESI------VYTVRVQPICIFLDPALKGSVEKLKTFRALGW 163

  Fly   378 G 378
            |
  Fly   164 G 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15046NP_573298.1 CLIP 35..82 CDD:197829
CLIP 168..215 CDD:197829 4/14 (29%)
Tryp_SPc 274..>379 CDD:473915 22/120 (18%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 29/173 (17%)
Tryp_SPc 317..512 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.