DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42323 and CG7548

Sequence 1:NP_001138219.1 Gene:CG42323 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648131.1 Gene:CG7548 FlyBaseID:FBgn0035792 Length:197 Species:Drosophila melanogaster

Alignment Length:260 Identity:64/261 (25%)
Similarity:94/261 (36%) Gaps:64/261 (25%)


  Fly     1 MAFKVILSVVLVALIACVQAKPGGPAAYSISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQVQ 65
            ||:...|||....|:.......|..|..:|:....:|| |..||::.|:...|  :.|.||..:.
  Fly     1 MAYFQFLSVASSLLLLLAPTWAGLIAQPTITYAGNEHA-VAHTQQNVVRSFDG--TVSHYAKSLA 62

  Fly    66 TAHSQSHVQRSSISNDAGLAPVA-AHGYAAAPAHAIAAPAYSLGYAGHTAPAQIQGVAYGGHYAA 129
            |.:||.|.|.:.|||:.....|| ...||.||     ||.|:  :..|..|..:        :..
  Fly    63 TPYSQVHKQDTRISNNVYQPAVAKTFSYATAP-----APVYT--HQAHQEPKNL--------FTQ 112

  Fly   130 SAPAVQISGLGHSLGLGHSLGLGQSLGLGGYGGYGYGGYGSYSAAPVISHGYLAHAPVAAAPVVK 194
            ::|..|......:..:                         |..|..:....:.|.|   |.|..
  Fly   113 ASPVYQQDAHVQTPSV-------------------------YQQAAHVQTPSVYHQP---AQVQS 149

  Fly   195 YAAAPSYAPGIIGHGIGLAAPAYAAPAYAAPAYATHLAGPVVKAAVAAPALVHTSVSGHGIHYGY 259
            |     :.||.:      .||:    .|...|:.:|  .|.|.....|..:.|.|..|.|.|||:
  Fly   150 Y-----HQPGHV------EAPS----VYQQNAHYSH--QPAVIHYSPAETVSHMSFDGFGTHYGF 197

  Fly   260  259
              Fly   198  197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42323NP_001138219.1 None
CG7548NP_648131.1 Cuticle_3 35..197 CDD:287932 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR39068
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.