DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42323 and CG8543

Sequence 1:NP_001138219.1 Gene:CG42323 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648126.1 Gene:CG8543 FlyBaseID:FBgn0035787 Length:219 Species:Drosophila melanogaster

Alignment Length:287 Identity:84/288 (29%)
Similarity:109/288 (38%) Gaps:96/288 (33%)


  Fly     1 MAFKVILSVVLVALI----------ACVQAKPGGPAAYSISAPSVDHASVGSTQEHTVKGHYGQS 55
            ||||.:| :...||:          |...|....|....::.|..|  :||:||::.|:...|  
  Fly     1 MAFKYVL-LSFCALVGVASAGFLAPATTYAAASIPVVAKVAQPHYD--AVGTTQQNVVRSFGG-- 60

  Fly    56 SQSDYASQVQTAHSQSHVQRSSISND--------AGLAPVAAHG-YAAAPAHAIAAPAYS--LGY 109
            :.|.|:..|.|.:|......|.|:|:        :..|||.... ||||||..:|...||  :..
  Fly    61 TVSTYSKNVVTPYSSVSKVDSRITNNVYTPKTLYSAPAPVITKSFYAAAPAPVVAKTVYSAPVAK 125

  Fly   110 AGHTAPAQIQGVAYGGHYAASAPAVQISGLGHSLGLGHSLGLGQSLGLGGYGGYGYGGYGSYSAA 174
            |.:.|||.:        |||.||.|..:                                .|| |
  Fly   126 AVYAAPAPV--------YAAPAPVVAKT--------------------------------VYS-A 149

  Fly   175 PVISHGYLAHAPVAAAPVVKYAAAPSYAPGIIGHGIGLAAPAYAAPAYAAPAYATHLAGPVVKAA 239
            ||....|.|.|||.:||                      ||..|...|:|||...|...|:|.||
  Fly   150 PVAKAVYAAPAPVYSAP----------------------APVVAKTVYSAPAPVYHAPAPLVAAA 192

  Fly   240 VAA-----PALV--HTSVSGHGIHYGY 259
            .||     ||.|  |.|..|.|.|:||
  Fly   193 PAAYVKYSPAAVVAHASFDGFGSHWGY 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42323NP_001138219.1 None
CG8543NP_648126.1 Cuticle_3 43..219 CDD:287932 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR39068
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.