DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42323 and C17H11.2

Sequence 1:NP_001138219.1 Gene:CG42323 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_509378.1 Gene:C17H11.2 WormBaseID:WBGene00015922 Length:738 Species:Caenorhabditis elegans

Alignment Length:51 Identity:13/52 (25%)
Similarity:21/52 (40%) Gaps:1/52 (2%)


  Fly    25 PAAYSISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQVQTAHSQSHVQR 75
            |......||..|.....::||:|.......||..| :|.:....:||.:.:
 Worm   333 PEDDGFEAPDEDLLQEVTSQENTASPETAPSSSED-SSPMVDEETQSSIDK 382



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E2SE
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.