DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and AT1G61620

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_564781.1 Gene:AT1G61620 AraportID:AT1G61620 Length:310 Species:Arabidopsis thaliana

Alignment Length:306 Identity:93/307 (30%)
Similarity:159/307 (52%) Gaps:25/307 (8%)


  Fly     3 RHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLFDK 67
            ||::|....|.:||:|||:    .||||..:|||:||:|.||.|||.|:|...|:....|::|.:
plant     4 RHSKNNNDLAYFTYDEKKK----LGYGTQRERLGRDSIKPFDACSLCLKPFIDPMCCHKGHVFCR 64

  Fly    68 EAILQYIVTKKNEYSRRLKEYERLRRAEEDKLSQEANSKQQAR-MERFVNAEKPAMTPAHSSAAA 131
            |.||:..:.:|.:..|||..:...::.::|: .:|....|:|| ::.|......|| |.:|....
plant    65 ECILECFLAQKKDIQRRLAAHSSQKKQDKDE-EEERLMLQKARELDEFDQQNHSAM-PRNSDKNH 127

  Fly   132 SEKPSTSSAAAAASSESSSASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIYCPVSQK 196
            :|..:....|.:..:.|....::..|        .:|||||..|.|.: :...|:....||..::
plant   128 NEDKNGFHGANSVKTTSFEEEALRTM--------KAFWLPSATPAASV-RVDAPETHTVCPEGKE 183

  Fly   197 PLRVKDLIDVKFTLLKDGDTKRSLIAKEA-------RYMCPITHDVLSNAVPCAVLRPTGDVVTM 254
            .|::|:|..::||  :|...:.....|.|       .|:||.....|:|.:....|...|.|...
plant   184 KLKLKNLFAIRFT--EDNSEEEETKTKSASSSSYDKSYICPSCKVTLTNTMSLVALSSCGHVFCK 246

  Fly   255 ECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKE 300
            :|.|:.:..|.:..:.|:..|:::::.|::||||:|..:|||:|||
plant   247 KCAEKFMPVDKVCLVCDKPCKDRNLVGLKKGGTGFAEHDDHLEAKE 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 31/74 (42%)
RING <200..>282 CDD:302633 20/89 (22%)
AT1G61620NP_564781.1 zf-NOSIP 5..75 CDD:318178 31/74 (42%)
DWNN <78..301 CDD:331509 60/229 (26%)
RING1-HC_LONFs 221..263 CDD:319427 10/42 (24%)
RING-HC finger (C3HC4-type) 221..262 CDD:319427 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 149 1.000 Inparanoid score I1666
OMA 1 1.010
OrthoDB 1 1.010 D1567031at2759
OrthoInspector 1 1.000 T192705
orthoMCL 1 0.900 OOG5_129487
Panther 1 1.100 LDO PTHR13063
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.