DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and Nosip

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006541141.1 Gene:Nosip MGIID:1913644 Length:328 Species:Mus musculus

Alignment Length:330 Identity:158/331 (48%)
Similarity:205/331 (62%) Gaps:25/331 (8%)


  Fly     1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLF 65
            ||||.:||||||||||:|||:|.|.|||||...||.:|:||.||||.|:||||..||:|.||||:
Mouse     1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLY 65

  Fly    66 DKEAILQYIVTKKNEYSRRLKEYERLR--RAEEDKLSQEANSKQQARMERFVNAE--------KP 120
            ::||||:||:.:|.|.:|::|.||:.|  |.||.|..|.|.::.|.|  .|:..|        .|
Mouse    66 EREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVR--GFLEKEAAIVSRPLNP 128

  Fly   121 AMTPAHSSAAASEK---PSTSSAAAA---------ASSESSS-ASSISNMTNGHEKKLPSFWLPS 172
            .|..|.:.....:|   |...|....         .|:|... ..|:..:....:|.|||||:||
Mouse   129 FMPKAATLPNTGDKKYLPLVGSLGGGFLKCVPQLLPSTEGEQPGPSVGPVGKDKDKALPSFWIPS 193

  Fly   173 ECPNAGLAKAQKPDATIYCPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLS 237
            ..|.|...|.:||..|:.||:|.||||:.||..|:||.|.|...:..||.:..||:|.:|.|.||
Mouse   194 LTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLS 258

  Fly   238 NAVPCAVLRPTGDVVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKEKR 302
            ||.|||||||:|.|||:||||:||||||:.|:....|.|:|||.|||||||:|.:...|||:..|
Mouse   259 NATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAGSGVKLQAEMSR 323

  Fly   303 PMLQA 307
            |::||
Mouse   324 PVMQA 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 48/74 (65%)
RING <200..>282 CDD:302633 45/82 (55%)
NosipXP_006541141.1 zf-NOSIP 4..78 CDD:292528 48/74 (65%)
RING <221..>303 CDD:302633 45/82 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160686740
eggNOG 1 0.900 E1_KOG3039
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 294 1.000 Inparanoid score I2717
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006016
OrthoInspector 1 1.000 T1085161
orthoMCL 1 0.900 OOG5_129487
Panther 1 1.100 LDO PTHR13063
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2684
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.