DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and NOSIP

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_024307296.1 Gene:NOSIP HGNCID:17946 Length:348 Species:Homo sapiens

Alignment Length:358 Identity:157/359 (44%)
Similarity:204/359 (57%) Gaps:62/359 (17%)


  Fly     1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLF 65
            ||||.:||||||||||:|||:|.|.|||||...||.:|:||.||||.|:||||..||:|.||||:
Human     2 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLY 66

  Fly    66 DKEAILQYIVTKKNEYSRRLKEYERLR--RAEEDKLSQEANSKQQARMERFVNAEKPAMTPAHSS 128
            ::||||:||:.:|.|.:|::|.||:.|  |.||.|..|.|.|:...|  .|:..|         |
Human    67 EREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVR--GFLEKE---------S 120

  Fly   129 AAASE--KPSTSSAAAAASSES-SSASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKP----- 185
            |..|.  .|.|:.|.:..|.:. ....|:...:...:|.|||||:||..|.|...|.:||     
Human   121 AIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPVSPHS 185

  Fly   186 -----------------------------------------DATIYCPVSQKPLRVKDLIDVKFT 209
                                                     ..|:.||:|.||||:.||..|.||
Human   186 APARTVPGRQGSPPSSSRTGTTRSPPAPALPTEPASLCPLQSRTVTCPMSGKPLRMSDLTPVHFT 250

  Fly   210 LLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGDVVTMECVERLIRKDMIHPLTDRKL 274
            .|.....:..||.:..||:|.:|.|.||||.|||||||:|.|||:||||:||||||:.|:|..||
Human   251 PLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKL 315

  Fly   275 KEKDIIPLQRGGTGYATTNDHLQAKEKRPMLQA 307
            .::|||.|||||||:|.:...|||::.||::||
Human   316 TDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 48/74 (65%)
RING <200..>282 CDD:302633 45/82 (55%)
NOSIPXP_024307296.1 zf-NOSIP 5..79 CDD:318178 48/74 (65%)
Herpes_ICP4_C 139..>282 CDD:332854 40/143 (28%)
RING-Ubox2_NOSIP 267..331 CDD:319576 44/64 (69%)
U-box domain, a modified RING finger 270..311 CDD:319576 29/41 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160687953
eggNOG 1 0.900 E1_KOG3039
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 295 1.000 Inparanoid score I2705
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1567031at2759
OrthoFinder 1 1.000 FOG0006016
OrthoInspector 1 1.000 T1075060
orthoMCL 1 0.900 OOG5_129487
Panther 1 1.100 LDO PTHR13063
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2684
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.