DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and nosip

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_989029.1 Gene:nosip XenbaseID:XB-GENE-945889 Length:298 Species:Xenopus tropicalis

Alignment Length:312 Identity:153/313 (49%)
Similarity:216/313 (69%) Gaps:19/313 (6%)


  Fly     1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLF 65
            ||||.:||||||||||.|||:|.|.|||||...||.||:||.||||.|:||||:.||:|.|||::
 Frog     1 MTRHGKNCTAGAVYTYYEKKKDTAASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTSDGYIY 65

  Fly    66 DKEAILQYIVTKKNEYSRRLKEYERLRRAEEDKLSQEANSKQQARMERFVNAE-----KPAMTPA 125
            :|||||:||:.:|.|.:|::|.|::.:.|::.::.:...:.::::|:.|::.|     ||.    
 Frog    66 EKEAILEYILHQKKEIARQMKAYDKQKNAKKAEMDELNKAAKESQMKAFLDKEMTIVSKPL---- 126

  Fly   126 HSSAAASEKPSTSSAAAAASSESSSASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIY 190
                    .|.|..:.:.|.:...|.|..|:...|  |:|||||:||..|.|..:..:|||.|:|
 Frog   127 --------NPFTRKSDSGADTAEPSGSQQSSEEKG--KQLPSFWIPSLTPEAKTSLVKKPDKTVY 181

  Fly   191 CPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGDVVTME 255
            ||:|.|||::||||.|.||.:.:...:..||.::.||:|.:|.|:|.|:||||||||:|.|||||
 Frog   182 CPMSGKPLKMKDLIPVHFTAVDEKVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGAVVTME 246

  Fly   256 CVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKEKRPMLQA 307
            |||:||:||||.|::..||.|:|||.|||||||::.:...|||||.||::||
 Frog   247 CVEKLIKKDMIDPISGDKLHERDIIMLQRGGTGFSGSGVLLQAKEARPVMQA 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 49/74 (66%)
RING <200..>282 CDD:302633 46/82 (56%)
nosipNP_989029.1 zf-NOSIP 4..78 CDD:318178 49/74 (66%)
Nuclear localization signal. {ECO:0000250} 78..101 6/23 (26%)
RING-Ubox2_NOSIP 217..281 CDD:319576 44/64 (69%)
U-box domain, a modified RING finger 220..261 CDD:319576 29/41 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160693330
eggNOG 1 0.900 E1_KOG3039
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 308 1.000 Inparanoid score I2447
OMA 1 1.010
OrthoDB 1 1.010 D1567031at2759
OrthoFinder 1 1.000 FOG0006016
OrthoInspector 1 1.000 T1061111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2684
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.