| Sequence 1: | NP_573288.1 | Gene: | CG6179 / 32819 | FlyBaseID: | FBgn0030915 | Length: | 307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038960909.1 | Gene: | Nosip / 292894 | RGDID: | 1309992 | Length: | 328 | Species: | Rattus norvegicus |
| Alignment Length: | 52 | Identity: | 15/52 - (28%) |
|---|---|---|---|
| Similarity: | 26/52 - (50%) | Gaps: | 5/52 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 ESFFASAQFFSLTLYTIGFFSFPIHLFGAYCILFQTPESMKSVKWSMFNLHF 55 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6179 | NP_573288.1 | zf-NOSIP | 4..78 | CDD:318178 | 15/52 (29%) |
| RING-Ubox2_NOSIP | 226..293 | CDD:438324 | |||
| Nosip | XP_038960909.1 | zf-NOSIP | 4..78 | CDD:318178 | |
| RING-Ubox2_NOSIP | 247..314 | CDD:438324 | 8/31 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||