DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6179 and Nosip

DIOPT Version :10

Sequence 1:NP_573288.1 Gene:CG6179 / 32819 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_038960909.1 Gene:Nosip / 292894 RGDID:1309992 Length:328 Species:Rattus norvegicus


Alignment Length:52 Identity:15/52 - (28%)
Similarity:26/52 - (50%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESFFASAQFFSLTLYTIGFFSFPIHLFGAYCILFQTPESMKSVKWSMFNLHF 55
            ||::.||...|.:.:..|..|.||:..|    :|...:..:.|::|. |.|:
  Rat   226 ESYYDSASPESSSPHFDGQMSPPINYNG----IFSLKKHDEQVEYSK-NCHY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:318178 15/52 (29%)
RING-Ubox2_NOSIP 226..293 CDD:438324
NosipXP_038960909.1 zf-NOSIP 4..78 CDD:318178
RING-Ubox2_NOSIP 247..314 CDD:438324 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.