DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and Nosip

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001099730.1 Gene:Nosip RGDID:1309992 Length:301 Species:Rattus norvegicus

Alignment Length:312 Identity:156/313 (50%)
Similarity:203/313 (65%) Gaps:16/313 (5%)


  Fly     1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLF 65
            ||||.:||||||||||:|||:|.|.|||||...||.:|:||.||||.|:||||..||:|.||||:
  Rat     1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLY 65

  Fly    66 DKEAILQYIVTKKNEYSRRLKEYERLR--RAEEDKLSQEANSKQQARMERFVNAEKPAMTPAHSS 128
            ::||||:||:.:|.|.:|::|.||:.|  |.||.|..|.|.::.|.|  .|:..|         |
  Rat    66 EREAILEYILHQKREIARQMKAYEKQRGARREEQKELQRAAAQDQVR--GFLEKE---------S 119

  Fly   129 AAASE--KPSTSSAAAAASSESSS-ASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIY 190
            |..|.  .|....||...:::... ..|:..:....:|.|||||:||..|.|...|.:||..|:.
  Rat   120 AIVSRPLNPFMPKAATLPNTDGEQPGPSVGPLGKDKDKALPSFWIPSLTPEAKATKLEKPSRTVT 184

  Fly   191 CPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGDVVTME 255
            ||:|.||||:.||..|:||.|.|...:..||.:..||:|.:|.|.||||.|||||||:|.|||:|
  Rat   185 CPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLE 249

  Fly   256 CVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKEKRPMLQA 307
            |||:||||||:.|:....|.|:|||.|||||||:|.:...|||:..||::||
  Rat   250 CVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAGSGVKLQAEMSRPVMQA 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 48/74 (65%)
RING <200..>282 CDD:302633 45/82 (55%)
NosipNP_001099730.1 zf-NOSIP 4..78 CDD:292528 48/74 (65%)
RING <194..>276 CDD:302633 45/82 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160690111
eggNOG 1 0.900 E1_KOG3039
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 295 1.000 Inparanoid score I2616
OMA 1 1.010
OrthoDB 1 1.010 D1567031at2759
OrthoFinder 1 1.000 FOG0006016
OrthoInspector 1 1.000 T1088708
orthoMCL 1 0.900 OOG5_129487
Panther 1 1.100 LDO PTHR13063
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.