DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6179 and R05G6.4

Sequence 1:NP_573288.1 Gene:CG6179 FlyBaseID:FBgn0030915 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_501214.1 Gene:R05G6.4 WormBaseID:WBGene00019898 Length:310 Species:Caenorhabditis elegans

Alignment Length:318 Identity:136/319 (43%)
Similarity:192/319 (60%) Gaps:22/319 (7%)


  Fly     1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLF 65
            ||||.:|.||.:||||:|::|||..|||||...|||.||:|.|.||||||||||.|||:..||:|
 Worm     1 MTRHGKNSTAASVYTYHERRRDAKASGYGTLHARLGADSIKEFHCCSLTLQPCRNPVISPTGYIF 65

  Fly    66 DKEAILQYIVTKKNEYSRRLKEYERLRRAEEDKLSQEANSKQQARMER--FVNAEKPAMTPAHSS 128
            |:||||:.|:.:|..|:::|||||: :.|||...::.|..:.:...:|  |...|.   ||:.:.
 Worm    66 DREAILENILAQKKAYAKKLKEYEK-QVAEESAAAKIAEGQAETFTKRTQFSAIES---TPSRTG 126

  Fly   129 AAASEKPST----------SSAAAAASSESSSASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQ 183
            |.|:.:|..          |:..||..........:|||.......|||||:|...|.|...|.:
 Worm   127 AVATPRPEVGSLKRQGGVMSTEIAAKVKAHGEEGVMSNMKGDKSTSLPSFWIPELNPTAVATKLE 191

  Fly   184 KPDATIYCPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPT 248
            ||.:.:.||||.||:::|:|::||||.:...:|     |...:::||:|.|.|:|...||.|:.:
 Worm   192 KPSSKVLCPVSGKPIKLKELLEVKFTPMPGTET-----AAHRKFLCPVTRDELTNTTRCAYLKKS 251

  Fly   249 GDVVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKEKRPMLQ 306
            ..||..:.||:||:.|.|.|:....:.|.|||.||||||||:.||: .:||..||.|:
 Worm   252 KSVVKYDVVEKLIKGDGIDPINGEPMSEDDIIELQRGGTGYSATNE-TKAKLIRPQLE 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6179NP_573288.1 zf-NOSIP 4..78 CDD:292528 46/74 (62%)
RING <200..>282 CDD:302633 30/82 (37%)
R05G6.4NP_501214.1 zf-NOSIP 4..78 CDD:292528 46/74 (62%)
RING <190..>285 CDD:302633 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C160683189
eggNOG 1 0.900 E1_KOG3039
Hieranoid 1 1.000
Homologene 1 1.000 H9315
Inparanoid 1 1.050 249 1.000 Inparanoid score I2002
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1567031at2759
OrthoFinder 1 1.000 FOG0006016
OrthoInspector 1 1.000 T477082
orthoMCL 1 0.900 OOG5_129487
Panther 1 1.100 LDO PTHR13063
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2684
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.