DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: upd2 and upd1

Sequence 1:NP_001356882.1 Gene:upd2 FlyBaseID:FBgn0030904 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001097015.1 Gene:upd1 FlyBaseID:FBgn0004956 Length:413 Species:Drosophila melanogaster

Alignment Length:443 Identity:122/444 (27%)
Similarity:189/444 (43%) Gaps:114/444 (26%)


  Fly    29 SRQVLLVIMILSVVMPFTKARHLRDQVALDYAYDEDNSGRSSSSSSSSSSSGGDILPAFDVNPYR 93
            :|.:||::.||.|::...:..||.:             ||      |::||||  |...|....|
  Fly     2 ARPLLLLLPILLVLLLAAQLPHLAE-------------GR------STTSSGG--LTVIDSERLR 45

  Fly    94 GLADSFGEGSYDSDMSLSESSYEEIAQAAIRA-ARREMRRQRTRHARSHNLRLFSGKSEIPEWEN 157
            ....|            |.:|.:...|..|.| |....:|.|.|::...:.|.|...:...||.|
  Fly    46 IRTTS------------STASAQHPNQGTIPASAASPRKRHRKRNSNWIDYRNFDENTTALEWAN 98

  Fly   158 PCGGTYTPDESLSDSSASQGRVIKRKHLENLRNITMSEYQDI--THRATLEYGNLQHWQ---REY 217
            ||||.|.|  |..|..   .|...|:....|:.....||:.:  :..:.::..|:..|.   ..|
  Fly    99 PCGGNYHP--SAGDRF---NRQRPRQSFNQLKRHAFREYRSLNSSQDSAIDIRNMTMWSLHTHNY 158

  Fly   218 KFLPNMTRPTSAVKLKTWYRHMQTFVGSFSYLGRAQYKFRKDQQKSLNEAVT-KELHDLLVSARY 281
            ||||.: :|.|.:.||.|||:|||:|.||:||.|.|  .|.||:....|:.| :||.:||:|:|.
  Fly   159 KFLPKL-KPNSTIALKRWYRNMQTYVASFAYLRRQQ--IRWDQRSITRESSTARELRELLLSSRR 220

  Fly   282 MLCEIELTINASY-PNSN-----------------GAKLSRVSRQAMEERLNFHTPANG------ 322
            :|||:|..:|.:. |...                 |.:|.::||..|.:||...:..:|      
  Fly   221 ILCELETAVNQTQSPRQKQRRSGAAVTAVGGTTMLGQQLPQISRLEMNKRLKLRSKTSGPGMGGA 285

  Fly   323 ----SM---EADQRDLKVSKELYFQYLNNVWKTLH----RVLRRPRRNSAERRHLAAIHGTGASG 376
                ||   |||..|::..|..|:.:|..:::.|.    ||..|||::..:::.       ....
  Fly   286 ASSASMAAGEADSIDMRFVKHHYYDFLRTMYQLLRRDGKRVRSRPRKHHKKQQR-------SQKK 343

  Fly   377 LRAGSSEMLD-------VGSSNG----------SGGSSG-------SDGGSNE 405
            |.....::.|       ..:.||          :||::|       |.||||:
  Fly   344 LLQQQQQLADQLEQRWRSSTLNGKEFNEVSKPVAGGAAGVADVAGVSGGGSNQ 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
upd2NP_001356882.1 None
upd1NP_001097015.1 Unpaired 71..333 CDD:292594 85/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134633589
eggNOG 1 0.900 E1_2F77T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.