DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Frq1 and CBL7

DIOPT Version :10

Sequence 1:NP_573271.1 Gene:Frq1 / 32797 FlyBaseID:FBgn0030897 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:38 Identity:12/38 - (31%)
Similarity:21/38 - (55%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VSVITQKLNR-HLFKALVVQTLIPICICFFPCMVAWYG 267
            :|::.|::.| |.|...:.:.:|..|:|.....||.||
plant   226 ISLLKQQIFREHQFHPSIQRWIIGQCLCSDDRTVASYG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Frq1NP_573271.1 EFh 39..89 CDD:415501
FRQ1 <69..173 CDD:444056
CBL7NP_194386.1 FRQ1 <76..180 CDD:444056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.