DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-1 and ari-2

Sequence 1:NP_001245736.1 Gene:ari-1 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster

Alignment Length:513 Identity:176/514 (34%)
Similarity:279/514 (54%) Gaps:44/514 (9%)


  Fly     1 MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREII 65
            |:||||.::.|:.|..|.          |.:.|:.....::.|.:.::|:.||.::|.:...|.:
  Fly     9 MESDNDGEYDDDYDYYNT----------GEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERV 63

  Fly    66 DEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINP---------FNATEAI 121
            ::.|.:|::.....::||...:|:...::|||..| .:.....|.:..|         .:|..|.
  Fly    64 EKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQD-ANALLVTARIKPPSVAVTDTASTSAAAAS 127

  Fly   122 KQ---------KTSRS-----QCEECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGL 172
            .|         ||:.|     :.:.|.:|.|....|....|.|||.||..||..|..|:|. :|:
  Fly   128 AQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIF-QGI 191

  Fly   173 GQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYA 237
            ...|.|.|..|::.|.:..|..|||...:|.||||.....:|:.:..||:||..:|...|:....
  Fly   192 STQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEI 256

  Fly   238 EPRRVHCKCGHV-FCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKD 301
            ..:|..||..|. |||.||.::|.|..|:.:|||:.||.|||||:|:|:|:||:||:|.:.|||:
  Fly   257 SAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKN 321

  Fly   302 GGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYN 366
            ||||||.|  .|||::|||:|||.|:.|||.:|.|:||.::..........:.|.:|.:|||||.
  Fly   322 GGCNHMQC--FNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYYE 384

  Fly   367 RYMNHMQSMKFENKLYASVKQKM-EEMQQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLK 430
            |:.||.:|:|.|.:....::|:: .::...:.:||:.|:|..|..:|.:||.||.|||.:|||::
  Fly   385 RWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYME 449

  Fly   431 KNNQSMIFEDNQKDLESATEMLSEYLERDITSENLADIKQKVQDKYRYCEKRCSVLLK 488
            ..::..:||..|..||:..|.||..:||..|:: |.|::.::.    ..|||.:.|||
  Fly   450 AGSRKNLFEYQQAQLEAEIENLSWKIERAETTD-LGDLENQMD----IAEKRRTTLLK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-1NP_001245736.1 IBR 204..264 CDD:214763 22/61 (36%)
IBR <286..326 CDD:279784 25/40 (63%)
ari-2NP_477374.1 IBR 222..284 CDD:214763 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64727610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I946
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 P PTHR11685
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.