DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Taf8 and TAF8

Sequence 1:NP_523397.1 Gene:Taf8 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_567964.1 Gene:TAF8 AraportID:AT4G34340 Length:353 Species:Arabidopsis thaliana

Alignment Length:199 Identity:47/200 (24%)
Similarity:86/200 (43%) Gaps:29/200 (15%)


  Fly    23 VSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLAL-------- 79
            |:|:....|.....:.:||:|:......|.::|.:|.::..|:||:...|.|:.|||        
plant    35 VAQVCESVGYENFKDPALESLSGFALQYILQLGKTATSFANLTGRSQCNVFDIILALDDLTDNNG 99

  Fly    80 ----------INMGISISNLDPYMRKETHVPI--PLP--PQQTQQRPLSLLQAGI---KAPHPHY 127
                      :...|.:..:..::.....||.  |||  |.....|...::.:.:   :.|...:
plant   100 E
QGISSESCSLGRSIKLREIIDFVNSSEEVPFSQPLPSFPVAISDRSRKMIPSFVEIGETPPGKH 164

  Fly   128 VPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKAL----TKFLCKTTETNNLFPT 188
            :|.:.|..||||.|..||...:.|::....:.:.|.|:|..|:||    .|.:||.:..|.::..
plant   165 IPLWLPAFPDPHTYKETPMWIERVSDPRGDKIEQARQRRKAERALLSLQRKLVCKISSRNPVWGD 229

  Fly   189 EDNM 192
            .|.:
plant   230 MDGV 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 18/83 (22%)
TAF8 126..179 CDD:176263 19/57 (33%)
TAF8NP_567964.1 Bromo_TP 24..100 CDD:284856 17/65 (26%)
TAF8 164..216 CDD:176263 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2502
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T192712
orthoMCL 1 0.900 OOG5_130826
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
54.860

Return to query results.
Submit another query.