DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada3 and tada3l

Sequence 1:NP_001259667.1 Gene:Ada3 FlyBaseID:FBgn0030891 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_956220.1 Gene:tada3l ZFINID:ZDB-GENE-030131-6725 Length:429 Species:Danio rerio

Alignment Length:498 Identity:134/499 (27%)
Similarity:224/499 (45%) Gaps:121/499 (24%)


  Fly    71 DVPKLLPTIAAALQRPADDHLAAEDLDAVQLELEQMLSNVALRTRVLKAEYDSL-DKDEKRQDRR 134
            |..|:.|...|.|.|..||.:..|:||.:|||||.:||:.:.|.|.|:.:...| |..:|:.|:|
Zfish    19 DHVKVCPRYTAVLSRSEDDGIGIEELDTLQLELETLLSSASRRLRALEEQRQILTDWQDKKGDKR 83

  Fly   135 --KLDRVPGSPPCPASMLNGLLGIGSNSSTSLGSPLGGGGASSSSQSKRKRDEPTGVRKKHSSMT 197
              ||::.|..                              |:||..||.|: :...|:..|    
Zfish    84 FLKLEKDPDL------------------------------AASSRHSKPKK-QKLDVKGSH---- 113

  Fly   198 ILKQQGVSGGTSKHQAKNSPLVVHTDDSMDYLPTLAAANASGSVLPHHQPLPQLPKMTVPKNDTP 262
                 |...|..:.::||....|. |...:..|               |.:|:     .||||.|
Zfish   114 -----GPGPGPGRPKSKNIQTKVQ-DFEFEVDP---------------QDIPR-----NPKNDAP 152

  Fly   263 NKFWLSVEPYCMPLTNEDLRLIDDLLE------QYWGPLVPPVPPLGPHYSTVWAQEDIKALQPG 321
            |:||.||||||..:|||::|::::||:      :|:     .:|.||.|||..|||||:...:..
Zfish   153 NRFWASVEPYCADITNEEIRVLEELLKAPDDEAEYY-----KIPTLGKHYSQRWAQEDLLEERRE 212

  Fly   322 GARIKSNNSS--------------GMLKKAEGM----VDESITGPLTQRLVSALMEESLMTLPSE 368
            |||......|              .:|||:|..    .|....|||:|||:.||:||:::: |.|
Zfish   213 GARANDKKKSMMGPLSELDAKDVDALLKKSESQHEPPEDGCPFGPLSQRLLQALVEENIIS-PME 276

  Fly   369 QAAV----GEHSNSTTSSSNENTHSHSSSSANAAAAAASGNFRSLAMMKHGVGIEQRLKKTLIEN 429
            .:.:    |:...:.||..::.                     ....:.|...:|.|:::.|:..
Zfish   277 DSPIPDIPGKDDGAGTSPRSQG---------------------KAFSVPHTRSLEARIREELVSQ 320

  Fly   430 GLIDASE--FAAHEDVDEVLMEIKRVTTEISTISQFNSEELKRLRAVASEEIKRIAIKQKLDMVD 492
            ||:|:.|  ....|..||||.|:::...|:..::..|......|..:|.||:::..::|::.:.|
Zfish   321 GLLDSDERQGVGGESEDEVLAELQKRQAELKALTAHNRSRKLELLKLAREEMRKQELRQRVRVAD 385

  Fly   493 QEILECYKRMLQYRAKRKGHTIEEKQEILRLTNEQRLLADQLE 535
            .|::|.::|::..|.|::..|.:||.:..:...|:..:...|:
Zfish   386 NEVMEAFRRIMAARQKKRTPTKKEKDQAWKALKERESILKLLD 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ada3NP_001259667.1 Ada3 413..518 CDD:287205 30/107 (28%)
tada3lNP_956220.1 Ada3 304..428 CDD:287205 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130952137
eggNOG 1 0.900 E1_KOG4191
Hieranoid 1 1.000
Homologene 1 1.000 H4633
Inparanoid 1 1.050 157 1.000 Inparanoid score I4180
OMA 1 1.010
OrthoDB 1 1.010 D1026409at2759
OrthoFinder 1 1.000 FOG0005021
OrthoInspector 1 1.000 T1051872
orthoMCL 1 0.900 OOG5_134123
Panther 1 1.100 LDO PTHR13556
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R809
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.