DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada3 and Tada3

Sequence 1:NP_001259667.1 Gene:Ada3 FlyBaseID:FBgn0030891 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_006505301.1 Gene:Tada3 MGIID:1915724 Length:440 Species:Mus musculus

Alignment Length:500 Identity:139/500 (28%)
Similarity:228/500 (46%) Gaps:127/500 (25%)


  Fly    74 KLLPTIAAALQRPADDHLAAEDLDAVQLELEQMLSNVALRTRVLKAEYDSL-DKDEKRQDRRKL- 136
            |:.|...|.|.|..||.:..|:||.:|||||.:||:.:.|.|||:||...| |..:|:.|||.| 
Mouse    29 KVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLK 93

  Fly   137 ---DRVPGSPPCPASMLNGLLGIGSNSSTSLGSPLGGGGASSSSQSKRKRDEPTGVRKKHSSMTI 198
               |...|:||                  ..|.|           .|:|.:..||          
Mouse    94 LGRDHELGAPP------------------KHGKP-----------KKQKLEGKTG---------- 119

  Fly   199 LKQQGVSGGTSKHQAKN-SPLVVH---TDDSMDYLPTLAAANASGSVLPHHQPLPQLPKMTVPKN 259
               .|...|..:.::|| .|.:..   |||.:|                       :|:  :|||
Mouse   120 ---HGPGPGPGRPKSKNVQPKIQEYEFTDDPID-----------------------VPR--IPKN 156

  Fly   260 DTPNKFWLSVEPYCMPLTNEDLRLIDDLLEQYWGPLVPP--------VPPLGPHYSTVWAQEDIK 316
            |.||:||.||||||..:|:|::|.:::||:       ||        :||||.|||..|||||:.
Mouse   157 DAPNRFWASVEPYCADITSEEVRTLEELLK-------PPEDEAEHYKIPPLGKHYSQRWAQEDLL 214

  Fly   317 ALQPGGAR-----------------IKSNNSSGMLKKAEGM----VDESITGPLTQRLVSALMEE 360
            ..|..|||                 :.:.:...:|||:|..    .|....|.|||||:.||:||
Mouse   215 EEQKDGARAAAVADKKKGLIGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEE 279

  Fly   361 SLMTLPSEQAAVGEHSNSTTSSSNENTHSHSSSSANAAAAAASGNFRSLAMMKHGVGIEQRLKKT 425
            :::: |.|.:.:.:.|...:.:...:|...:.:...:              :.|...:|.|:|:.
Mouse   280 NIIS-PMEDSPIPDMSGKESGADGASTSPRNQNKPFS--------------VPHTKSLESRIKEE 329

  Fly   426 LIENGLIDASEFAAHEDVDEVLMEIKRVTTEISTISQFNSEELKRLRAVASEEIKRIAIKQKLDM 490
            ||..||:::.:..|.:..||||.|:::...|:..:|..|..:...|..:|.||:.|..::|::.|
Mouse   330 LIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRM 394

  Fly   491 VDQEILECYKRMLQYRAKRKGHTIEEKQEILRLTNEQRLLADQLE 535
            .|.|:::.:::::..|.|::..|.:||.:..:...|:..:...|:
Mouse   395 ADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLD 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ada3NP_001259667.1 Ada3 413..518 CDD:287205 31/105 (30%)
Tada3XP_006505301.1 Ada3 317..430 CDD:313433 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130947191
eggNOG 1 0.900 E1_KOG4191
Hieranoid 1 1.000
Homologene 1 1.000 H4633
Inparanoid 1 1.050 175 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005021
OrthoInspector 1 1.000 T1082502
orthoMCL 1 0.900 OOG5_134123
Panther 1 1.100 LDO PTHR13556
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R809
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.