DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and GDE1

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_015215.1 Gene:GDE1 SGDID:S000006031 Length:1223 Species:Saccharomyces cerevisiae

Alignment Length:397 Identity:78/398 (20%)
Similarity:139/398 (35%) Gaps:152/398 (38%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFAN-FDE-------- 56
            |||.:..:.|..|||..||:.|:.:|.|:       ..:..:::|:.:.|..| :||        
Yeast     1 MKFGKTFANHRIPEWSSQYVGYKSLKKMI-------KEITRLQEDIYRAHNKNSYDEGRPPTKMR 58

  Fly    57 --------------------NFFHYCDKELKKINTFYSEKLAEATRKFATLNA-----ELKTSI- 95
                                :||...|::::|::|||:.:.||..::|..|.:     |:|::: 
Yeast    59 DSSNSAQNYLDSPKIQKLLASFFFAVDRDIEKVDTFYNSQYAEYKKRFERLLSSNQFNEIKSTLV 123

  Fly    96 ---------------EESERSAKKSKGHKRHAALPDRK--ARELKLAFSEFYLSLILLQNYQNLN 143
                           :::.......||..:.:.|...|  ..|::...:|.......|:.|..||
Yeast   124 VDANKEDAVAQTLLTKDTREMNMLLKGTSQASRLSYHKDDLIEIQSILAELRKQFRNLKWYAELN 188

  Fly   144 HTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNIINETETTVTGELEGGDRQRAMKR 208
            ...|.|||||.||.:                                        |.::|.:..:
Yeast   189 KRAFGKILKKLDKKV----------------------------------------GTNQQMSTMK 213

  Fly   209 LRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVVVVSAIFHEISGENLKVTFRLYRGPLLIIEFIFL 273
            .|:.||             .|:...::...:.::..|:.:       ||||              
Yeast   214 TRILPL-------------QFANDSLITKDLSLLKTIWEQ-------VTFR-------------- 244

  Fly   274 IGVNIYG--WRSSGVNH-------------VLIFELDPRNHLSEQHLMELAAIFGVIWTLSMLSF 323
              :|.|.  .||:..|.             |.|.|.|.:..:.|  |..|.:...:|.|..|:|.
Yeast   245 --INSYERVMRSTSPNANANDNTEFFKIICVFIEEDDSKGLIRE--LTNLYSELSLIPTRIMISV 305

  Fly   324 LYSASLA 330
            |..|:|:
Yeast   306 LNKAALS 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 46/206 (22%)
SPX 3..158 CDD:281146 46/207 (22%)
EXS 258..597 CDD:281164 21/89 (24%)
GDE1NP_015215.1 COG5408 1..300 CDD:227695 73/384 (19%)
SPX_GDE1_like 2..204 CDD:269905 47/249 (19%)
ANK repeat 427..466 CDD:293786
Ank_2 432..535 CDD:289560
ANK repeat 468..501 CDD:293786
ANK 506..624 CDD:238125
ANK repeat 506..535 CDD:293786
Ank_2 508..603 CDD:289560
ANK repeat 540..569 CDD:293786
ANK repeat 572..603 CDD:293786
Ank_2 577..>642 CDD:289560
GDPD_YPL110cp_fungi 871..1219 CDD:176548
GDPD 877..1210 CDD:281062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.