DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and AT1G35350

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_174768.2 Gene:AT1G35350 AraportID:AT1G35350 Length:751 Species:Arabidopsis thaliana

Alignment Length:773 Identity:199/774 (26%)
Similarity:313/774 (40%) Gaps:196/774 (25%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFA---NFD------- 55
            |||.:...|.:.|||::.|::|..:|.:|..........||  ..||||..:   ||.       
plant     1 MKFGKEYVAQMIPEWQQAYMDYTCLKTILREIKTSQKRSES--QGVLKRKLSGRRNFSGLTKRYS 63

  Fly    56 --------EN----------------------------------FFHYCDKELKKINTFYSEKLA 78
                    ||                                  ||...|.|..|:|.||...:.
plant    64 RTFSSRDLENHDIMVHATTGDDGFEKYETTILKVSEVGRESELVFFKTLDLEFDKVNRFYRSNVE 128

  Fly    79 EATRKFATLNAEL---------------------KTSIEESERSAKKSKGH-------------- 108
            |..::...||.::                     ..|::.:...:|:.||.              
plant   129 ELVKEAVVLNRQMDALIAYRIKLDQPSTSWSCSETVSVDINALDSKEQKGKTLAEEMGIKVEENV 193

  Fly   109 -------KRHA----ALPDR----------------------------------KARE-LKLAFS 127
                   |..|    ::.||                                  |..| ||..|.
plant   194 SNGGDSTKETAPEALSVLDRIRLNKNQENPLSTIRNVLKLSNKEDIKFTKENLKKIEERLKNVFI 258

  Fly   128 EFYLSLILLQNYQNLNHTGFRKILKKHDKL-LRVDTGAKWRQEYVEASHFFTNKDIDNIINETET 191
            |||..|..|:||..||.....||:||:||: ||  ..||...|.|:.|:..::.:|:.::...|:
plant   259 EFYRKLRHLKNYSFLNTLAISKIMKKYDKIALR--NAAKLYMEMVDKSYLTSSDEINKLMLRVES 321

  Fly   192 TVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVV--------VVSAIFHE 248
            .......|.:|.:.|..||  |...::....||..|.|.|..:.|||.:        ::.|:.|:
plant   322 IFVEHFAGSNRSKGMNLLR--PKVTKEKHRITFSTGFFVGCTVSLVIALGLFIHARNIMGAVGHK 384

  Fly   249 ISGENLKVTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFG 313
            :..|.:   |.||.....::..:.:...|||.|:...||:..||.......|...|::.|:  ||
plant   385 LYMETM---FPLYSLFAFVVLHMIMYASNIYFWKRYRVNYPFIFGFKEGTELGYGHVLLLS--FG 444

  Fly   314 VIWTLSMLSFLYSASLAIPAFIN---------PLTLTLIMVLFLANPFHVLYHDARFWLWRITGR 369
             :.||::.:.|.:..:.:....|         ||.:..:::.....||::.|..:||:...:..|
plant   445 -LGTLALCAVLVNMDMEMDPNTNDYKTITELVPLFVVALVIAISVCPFNIFYRSSRFFFLMVLFR 508

  Fly   370 CVSAPFFHVGFADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEARD-ASICMEKD----FIIR 429
            |::||.:.|...||:|.|||.|...|:...|:.||:|    .|.:.:. .|.|...|    |.. 
plant   509 CIAAPLYKVNLPDFFLADQLTSQVQALRSLEFYICYY----GWGDFKQRQSTCKSSDVYSTFYF- 568

  Fly   430 PIVNCLPAWFRFAQCLRRY---RDSREAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNP 491
             ||..:|.|.||.||:||.   :|..:.|    ||.||..|.:.|...|..|.:..|        
plant   569 -IVAVIPYWSRFLQCVRRLIEEKDVSQGF----NALKYLLTIVAVCLRTAFSINRGN-------- 620

  Fly   492 YTW---LWIIASIVSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRF 553
             .|   .|:.:.: ::.|...|||..||||..:.:  .::|||:::......||.|::.::.||.
plant   621 -DWKIAAWVFSGL-ATFYGTYWDIVYDWGLLHRPS--KSWLREKLLVPHKSVYYVAMVVNVVLRL 681

  Fly   554 IWALSFYLTEMKIVSSDIMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISI 611
            .|..:.....:..:..:.|.::..|||:.||.:|||||||||||||.|||||.:.:.:
plant   682 AWLQTVLDFNISFLHRETMVALIAILEIIRRGIWNFFRLENEHLNNVGKFRAFKSVPL 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 58/287 (20%)
SPX 3..158 CDD:281146 58/289 (20%)
EXS 258..597 CDD:281164 105/359 (29%)
AT1G35350NP_174768.2 SPX_PHO1_like 2..295 CDD:269897 62/297 (21%)
SPX 3..300 CDD:281146 63/301 (21%)
EXS 391..725 CDD:281164 105/359 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 1 1.010
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.