DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and AT1G14040

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_172857.2 Gene:AT1G14040 AraportID:AT1G14040 Length:813 Species:Arabidopsis thaliana

Alignment Length:821 Identity:201/822 (24%)
Similarity:310/822 (38%) Gaps:230/822 (28%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAM-------------------------------LYLAV- 33
            |||.:..|:.:.|||::.|::|:.:|.:                               ||.|. 
plant     1 MKFGKEFSSQMVPEWQQAYMDYDFLKTLLKEIITFKRRTNNAPSHGGAKTGGGLNRKLTLYRAFS 65

  Fly    34 --------EEAPSVESVEDDV---------------------------LKRHFANFDENFFHYCD 63
                    :.:.|...||:.|                           .......::..||...|
plant    66 GLVSTPRHKRSNSSHDVEEGVQLTGSMRSGPILVNTTASHGYETTFLMAAEEGGEYELVFFRRLD 130

  Fly    64 KELKKINTFYSEKLAEATRKFATLNAELKTSI--------------------------------- 95
            .|..|::.||.:|:.|..::.|.||.::...|                                 
plant   131 DEFNKVDKFYRKKVEEVLKEAAMLNKQMDALIAFRVKVENPDGWRWEERTVEMTRLASDIATSAA 195

  Fly    96 --------------------------------------EESE----------------------- 99
                                                  ||.|                       
plant   196 ALSASTPAGAKSMKVRSQEHMEAIQEGGSSRAGLMEDDEEDEDEQNETSVVSTGAIDNETTTSRM 260

  Fly   100 RSAKKS---------------------KGHKRHAALPDRK-ARE--------LKLAFSEFYLSLI 134
            |.|:.|                     ||..:.:...|.| :||        ||.||.|||..|.
plant   261 RGARPSPIDVLGRVKINNTKETPRSTIKGVLKVSKQTDLKFSRENLMKVEESLKRAFIEFYQKLR 325

  Fly   135 LLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNIINETETTVTGELEG 199
            ||::|..||...|.|||||:||:...| ..|...:.|::|:..::.::..::...|.|.......
plant   326 LLKSYSFLNVLAFSKILKKYDKITSRD-ATKPYMKVVDSSYLGSSDEVMRLMERVEATFIKHFAN 389

  Fly   200 GDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSG---SFIVLVIVVVVSAIFHEISG--ENLKVTFR 259
            .:|.:||..||  |..:::....||..|..:|   |.||.::.::.:....|:.|  |.:...|.
plant   390 ANRAKAMNILR--PKAKRERHRITFSTGFSAGCVFSLIVALVAIIRTRNLLEMEGQKEYMNTMFP 452

  Fly   260 LYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVIWTLSMLSFL 324
            ||.....|:..|.:...|||.||...||:..||.......|..:.::.:....||:..|.:|:.|
plant   453 LYSLFGFIVLHIIVYAANIYYWRRYRVNYSFIFGFKQGTELGYRQVLLVGFSIGVLALLCVLANL 517

  Fly   325 -YSASLAIPAF-----INPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGFADF 383
             ..|.....|:     |.||.|...|.:.|..||:..|..:||:.......|::||.:.|...||
plant   518 DMEADPKTKAYQARTEILPLILLAAMFIVLVLPFNYFYRSSRFFFLTCLFHCLAAPLYKVTLPDF 582

  Fly   384 WLGDQLNSLATAILDFEYLICFYFTNGNWTEARD-ASICMEKD----FIIRPIVNCLPAWFRFAQ 443
            :|||||.|...||...|:.||:|    .|.:.|. .|.|.|.|    |..  ||..:|...|..|
plant   583 FLGDQLTSQVQAIRSIEFYICYY----GWGDFRHRKSTCKESDVYNTFFF--IVAVIPYVSRLLQ 641

  Fly   444 CLRRYRDSREAFPHL-VNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYTW--LWIIASIVSSC 505
            ||||..:.:.  |.. .|..||..|.:.|...|..|......|        |  |..:.|.:::.
plant   642 CLRRLFEEKN--PEQGYNGLKYFLTIVAVCLRTAYSIQKGQVA--------WRVLAAVFSFIAAI 696

  Fly   506 YAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLTEMKIVSSD 570
            :...||...||||.::.: :|.:||::::......|:.|::.::.|||.|..:........:...
plant   697 FCTYWDFVHDWGLLNRTS-KNRWLRDKLLVPQKKVYFIAMVLNVLLRFAWIQTVLDFNFSFMHRQ 760

  Fly   571 IMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISI 611
            .|.::...||:.||.:|||||||||||||.||:||.:.:.:
plant   761 TMVAIVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKSVPL 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 61/345 (18%)
SPX 3..158 CDD:281146 61/346 (18%)
EXS 258..597 CDD:281164 109/353 (31%)
AT1G14040NP_172857.2 SPX_PHO1_like 2..355 CDD:269897 63/354 (18%)
SPX 3..360 CDD:281146 63/358 (18%)
SPX <284..347 CDD:271919 26/63 (41%)
EXS 451..787 CDD:281164 109/353 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.