DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and AT2G03250

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001318190.1 Gene:AT2G03250 AraportID:AT2G03250 Length:719 Species:Arabidopsis thaliana

Alignment Length:713 Identity:155/714 (22%)
Similarity:260/714 (36%) Gaps:193/714 (27%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAML----------------------YLAVEEAPSVESVE 43
            |||.:..|:    ||::.|::|:.:|.::                      .|.:|:..:..:::
plant     1 MKFGKDFSS----EWQQAYVDYKYLKTLVKDINRFKRKTNLHGGQISLSSTVLEIEDGITTATIQ 61

  Fly    44 --DDVLKRHFANF----------DENFFHYCDKELKKINTFYSEKLAEATRKFATLN-------- 88
              ....:|:...|          :..||...|.|..|:..||.||:.|..::.|.||        
plant    62 VSSTASQRYETTFLMTAEKGGEYELVFFRRLDDEFNKVEKFYREKVDEVVKEAAVLNKQMDALIA 126

  Fly    89 ------------------------AEL-------------------------------------- 91
                                    |||                                      
plant   127 FRLKMKEESTVEMARFALHGVVSPAELAKNPSMKVHMEAIEEGGSSRAGRRSDEDDYYTDEEDHN 191

  Fly    92 --------------------------------KTSIEESERSAKKSKGHKRHAALPD--RKARE- 121
                                            |.:::.:.:|..|...|.......|  ||..| 
plant   192 DVFFTPANNLSKMKSSSSAFIEVLDSIKINNTKEALQSNTKSVLKVSNHTELKFSRDNLRKIEEK 256

  Fly   122 LKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNII 186
            |..||.||:..|..|::|..||.....|||.|:||:...| .||...:.|:.|...::.::..::
plant   257 LICAFVEFHRKLWYLKSYSFLNVLALSKILTKYDKITSRD-AAKSYMKMVDKSCLGSSDEVMKLM 320

  Fly   187 NETETTVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSG---SFIVLVIVVVVSAIFHE 248
            ...|.|...:...|:|.:.|..||..|..|:..  .||..|...|   |.||.::.:|.:....:
plant   321 ENVEATFIKQFTNGNRTKGMNILRPKPKRERHR--LTFSTGFLGGCMFSLIVALVAIVRTRNILQ 383

  Fly   249 ISGEN--LKVTFRLYRGPLLIIEFIFL----IGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLME 307
            ..|:.  :...|.||.    :..||.|    ...|||.||...||:..||.......|..:.::.
plant   384 DDGQKQYMNTMFPLYS----LFGFIMLHMTMYAANIYFWRQYRVNYSFIFGFKQGTELGYKQVLF 444

  Fly   308 LAAIFGVIWTLSMLSFL----------YSASLAIPAFINPLTLTLIMVLFLANPFHVLYHDARFW 362
            :....|.:..|.:|:.|          |.|...    :.||.|.:.|.:.|..||::.|..:||:
plant   445 VGFSIGALALLCVLANLDMETDPKTKDYQALTE----LLPLFLLIAMFVVLVVPFNIFYRSSRFF 505

  Fly   363 LWRITGRCVSAPFFHVGFADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEARD-ASICMEKD- 425
            ........::||.:.|...||:|.|||.|.|..:...|:.||:|    .|.:.:. .:.|.:.. 
plant   506 FLTTLFHMLAAPLYKVTLPDFFLADQLCSQAQTLRSIEFYICYY----GWGDFKQRKNTCKDSQV 566

  Fly   426 ---FIIRPIVNCLPAWFRFAQCLRRYRDSREAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYAST 487
               |:.  ||:..|.:.||.||:||..:.:.     :..|.....::|::.|..... :......
plant   567 FNTFLF--IVSAFPFFSRFLQCMRRMLEEKN-----IEQGYNGFKYIVIVVAVCLGM-AYEVDDE 623

  Fly   488 FDNPYTW--LWIIASIVSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILED 548
            .|....|  |..|.|.::..:...||:..||||.::.: :|.:||:.::......|..|::.|
plant   624 KDRQIIWRLLGGITSAMAVVFCTYWDLVYDWGLLNRTS-KNPWLRDNLLIPHKEVYVLAMVSD 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 51/293 (17%)
SPX 3..158 CDD:281146 51/294 (17%)
EXS 258..597 CDD:281164 79/313 (25%)
AT2G03250NP_001318190.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 292 1.000 Inparanoid score I804
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D536327at2759
OrthoInspector 1 1.000 T32210
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.