DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and xpr1b

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001119862.1 Gene:xpr1b ZFINID:ZDB-GENE-060503-266 Length:693 Species:Danio rerio

Alignment Length:688 Identity:381/689 (55%)
Similarity:482/689 (70%) Gaps:46/689 (7%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65
            |||.||||||||||||||||.||..|.|||.|.::|||:|..::|.:||::|.|:|.||..|:||
Zfish     1 MKFTEHLSAHITPEWRKQYIQYEAFKEMLYSAQDQAPSIEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAKKSKG--HKR---HAALPD----RKARE 121
            |.|||||||||||||.|:||||..||::|: :::|.:.::.|  |:|   |.:..:    |..::
Zfish    66 LAKINTFYSEKLAEAQRRFATLQNELQSSL-DAQRESSRAAGLRHRRTVFHLSQQERCKHRNIKD 129

  Fly   122 LKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNII 186
            |:||||||||||||||||||||.||||||||||||:.....||.||..:||.:.|:|.|.|..:|
Zfish   130 LQLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKIFETSRGADWRVAHVEVAPFYTCKKITQLI 194

  Fly   187 NETETTVTGELEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGSFIVLVIVVVVSAIFH-- 247
            :||||.||.||||||||:||||||||||| .|.:| ||||:|||:.|.|:.|.:.|:::.:..  
Zfish   195 SETETLVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFVALTVTVIIAGVVKLV 259

  Fly   248 EISGENLKV--TFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAA 310
            |..|:|..|  ..|:|||..|:|||:||:|:|.||||.:||||||||||:|||:||.|||.|:|.
Zfish   260 EHFGDNTDVWPLIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAG 324

  Fly   311 IFGVIWTLSMLSFLYSASLAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPF 375
            ..||:|.:|:||.|::.:..||..:|||.|.....|||.||....|:.:||||.::..|.|:|||
Zfish   325 FLGVLWCVSILSCLFAENTLIPIHMNPLALYGFFFLFLINPLKTCYYKSRFWLLKLLFRVVTAPF 389

  Fly   376 FHVGFADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEA-------RDASICMEKDFIIRPIVN 433
            ..||||||||.||||||...::|.||:||||....|||.:       ....||....:.:|.::.
Zfish   390 HRVGFADFWLADQLNSLVVVLMDLEYMICFYSLELNWTMSEGELWIKEGERICYSYSYGVRAVIK 454

  Fly   434 CLPAWFRFAQCLRRYRDSREAFPHLVNAGKYSTTFMVVIFATLKSFHSPNYASTFDNPYTWLWII 498
            ||||||||.||||||||::.|||||||||||||||.||||..|...||.      |..:.:|:|:
Zfish   455 CLPAWFRFVQCLRRYRDTKRAFPHLVNAGKYSTTFFVVIFEALFKTHSG------DERFVFLYIM 513

  Fly   499 AS--IVSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWA--LSF 559
            .:  ||:|||...||:||||||||:||||||.||||:||....:||.||:||:.|||.|.  ||.
Zfish   514 IACRIVNSCYTLLWDLKMDWGLFDRNAGENTLLREEIVYPQKAYYYCAIVEDVILRFAWTIPLSL 578

  Fly   560 YLTEMKIVSSDIMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILR 624
            .:...:.|.|:|:.:|...|||||||||||||||||||||||:||||||||:|||::.||.|:.:
Zfish   579 EVVYDRPVISNILGTVLPPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQ 643

  Fly   625 LMDEADGVINRYTKAN----------RPK---PKKVKD 649
            :||:.|||.||..|.|          ||:   ..||:|
Zfish   644 MMDQEDGVRNRLGKKNWKRSYSMSLRRPRLSSQSKVRD 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 100/163 (61%)
SPX 3..158 CDD:281146 100/164 (61%)
EXS 258..597 CDD:281164 193/350 (55%)
xpr1bNP_001119862.1 SPX_XPR1_like 2..164 CDD:269898 100/163 (61%)
SPX 3..172 CDD:281146 101/170 (59%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 157..164 7/7 (100%)
EXS 289..616 CDD:281164 183/333 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C196187596
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H129026
Inparanoid 1 1.050 740 1.000 Inparanoid score I560
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T128810
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.