DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and Y39A1A.22

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_499359.3 Gene:Y39A1A.22 WormBaseID:WBGene00012659 Length:710 Species:Caenorhabditis elegans

Alignment Length:701 Identity:324/702 (46%)
Similarity:435/702 (62%) Gaps:59/702 (8%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65
            |||.|.|::|:|||||||||:||.:|.:||..:.|.|:    :||..:.|.:..||.||:.||:|
 Worm     1 MKFGEQLASHLTPEWRKQYIDYERLKNLLYDDMMEVPA----DDDRREEHISRLDEKFFNECDQE 61

  Fly    66 LKKINTFYSEKLAEATRKFATLNAELK------------TSIEESERSAKKSKGHKRHAALPDRK 118
            |.|||.|:|:|:||...|...|..||:            |.|.  .|...|.|.||.    ..|.
 Worm    62 LTKINLFFSQKIAEGQGKHHELQTELQVFKDVLGSRSDTTGIR--RRFGGKDKFHKE----TTRN 120

  Fly   119 ARELKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDID 183
            .::||||||||||||:|:||:|.||.|||||||||||||...:.|..||...||.|.||.|::|:
 Worm   121 EQQLKLAFSEFYLSLVLVQNFQQLNATGFRKILKKHDKLTGNERGLDWRINKVEKSSFFLNREIE 185

  Fly   184 NIINETETTVTGELEGGDRQRAMKRLRVPPLGEQQSPWTTFKVGLFSGSFIVLVIVVVVSAIFHE 248
            .:|...||:|..:||.|:||..||||:||||.|:|.|.|||.:|||.|:.|:|::.::::.|...
 Worm   186 TLITNVETSVINDLEAGNRQAGMKRLKVPPLSEKQKPLTTFSLGLFIGASIILLLAILLTWIASP 250

  Fly   249 ISGENLK-VTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIF 312
            ...:..| |..||:|||||:...|||.|||:.||.::|||||||||:|||||||.|.||::|:..
 Worm   251 ARPQEPKWVAVRLFRGPLLLFLSIFLCGVNMAGWAAAGVNHVLIFEVDPRNHLSYQTLMQIASFM 315

  Fly   313 GVIWTLSMLSFLYSASLAIPAFINPLTLTLIMVLFLANPF----HVLYHDARFWLWRITGRCVSA 373
            .::|:.::|::||:..|.||.|..||.|.::.::.|.||.    .|.:.::||||.:...:|.::
 Worm   316 IMLWSFAVLAYLYAHMLHIPPFAPPLALMVVCLILLLNPIAKPDSVFHRNSRFWLLKHCYKCFTS 380

  Fly   374 PFFHVGFADFWLGDQLNSLATAILDFEYLICFY-----FTNGNWTEAR------------DASIC 421
            ||..|.|.|||||||:|||.||.|||:|.:|||     ::|| |.|.:            ...:.
 Worm   381 PFHFVTFTDFWLGDQMNSLTTAFLDFQYFVCFYATEVDYSNG-WIEVKGINSTTGSVPWGSVELS 444

  Fly   422 MEKDFI-----IRPIVNCLPAWFRFAQCLRRYRDSREAFPHLVNAGKYSTTFMVVIFATLKSFH- 480
            ..||..     :|.:::.:||..||.||||||||::...|||||||||||||.||....|..:: 
 Worm   445 NGKDQCASAAGLRSLMSIIPAMIRFLQCLRRYRDTKRVHPHLVNAGKYSTTFFVVACGALNKYYE 509

  Fly   481 --SPNYASTFDNPYTWLWIIASIVSSCYAYTWDIKMDWGLFDKNA-GENTFLREEVVYSSTGFYY 542
              .||..|.|    .::||::.|:|..|.:.|||.|||||.|..| .|..|||||::|.|..:||
 Worm   510 ATDPNTTSIF----FYIWILSYIMSFTYTFLWDIFMDWGLIDPRAPKEARFLREEMIYGSKWYYY 570

  Fly   543 FAILEDLALRFIWALSFYLTEMKIVSSDIMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVR 607
            .||.:|..||..|.|:..|.|...:.||.:|:||...||||||:||:|||||||:||||:|||||
 Worm   571 MAIAQDFVLRLAWVLNVSLGEAWTLDSDFLTTVTAPFEVFRRFIWNYFRLENEHVNNCGQFRAVR 635

  Fly   608 DISIAPLDSSDQALILRLMDEADGVINR-YTKANRPKPKKVKDPEKRSLLQ 657
            |||:.|:...|...:|..||:.|||.:| .....|.|.:|......|.||:
 Worm   636 DISVKPIRKGDLESLLSKMDQMDGVTHRGQDLMERVKKQKKSAKASRQLLR 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 81/166 (49%)
SPX 3..158 CDD:281146 82/167 (49%)
EXS 258..597 CDD:281164 171/369 (46%)
Y39A1A.22NP_499359.3 SPX_XPR1_like 2..158 CDD:269898 81/166 (49%)
EXS 262..625 CDD:308637 171/368 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 1 1.000 H129026
Inparanoid 1 1.050 597 1.000 Inparanoid score I516
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T374754
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
1413.820

Return to query results.
Submit another query.