DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and SPAC227.01c

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_592955.2 Gene:SPAC227.01c PomBaseID:SPAC227.01c Length:373 Species:Schizosaccharomyces pombe

Alignment Length:407 Identity:106/408 (26%)
Similarity:165/408 (40%) Gaps:110/408 (27%)


  Fly   266 LIIEFIFLIGVNIYGW----RSSGVNHVLIFEL--DP----RNHLSEQHLMELAAIFGVIWTLSM 320
            |::...||:...:|.:    ....:|.|.:|.|  .|    |:..:...|.:|:....::.||..
pombe    16 LVLRLFFLVVFGLYSFTLILHLLVINRVDVFSLLHTPLPVNRSQQANAPLWQLSFSLSILGTLLF 80

  Fly   321 L----SFLYSAS--LA-IPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWR---ITGRCVS--- 372
            :    .:|.|.|  || :|.||      ..:::|:  |.|      :||.::   .|.:|:.   
pombe    81 VIAESLYLISGSDELAYVPVFI------FGVIVFM--PVH------KFWFFQRKVFTRQCLRILG 131

  Fly   373 ---APFFHVGFADFWLGDQLNSLATAILDFEYL---ICFYFTNGNWTEARDASICMEKDFIIRPI 431
               .|.:.  |.|....|.|.|.:..|.|. :|   |..|.|:......|.    ..::.:|..:
pombe   132 GSYRPDYK--FPDVIFSDLLTSYSRVIADL-WLAGAILIYVTDSPNNSHRK----QYENEVIMSM 189

  Fly   432 VNCLPAWFRFAQCL--RRYRD-SREAFPHLVNAGKYSTTFMVV---IFATLKSFHSPNYASTFDN 490
            :...|...||.|||  |...| |.:.|...:|:.||.|.|..:   |||. |.|           
pombe   190 IAAYPYAIRFRQCLIERSSADNSSDKFWSTLNSIKYFTAFPAIFLGIFAK-KRF----------- 242

  Fly   491 PYTW-LWIIASIVSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGF--------YYFAIL 546
            .:.| ||..:|.::|.|::.||:.|||.|        .|.::.:...:..|        :.||::
pombe   243 SFLWFLWNTSSAINSTYSFWWDVSMDWSL--------PFFKQPLSIQNWKFGVRRLFPTFTFAVV 299

  Fly   547 E--DLALRFIWAL--------SFYLTEMKIVSSDIMTSVTGILEVFRRFVWNFFRLENEHLNNCG 601
            .  |..||..|.:        :|:.|:..|.       :...||||||.||.|||:|.|    ..
pombe   300 SAIDFVLRMAWVVRVLPEHQSAFFTTDFGIF-------IMQFLEVFRRCVWVFFRIEAE----AS 353

  Fly   602 KFRAVRDISIAPLDSSD 618
            |..|..:||    |.||
pombe   354 KSLAYVNIS----DRSD 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898
SPX 3..158 CDD:281146
EXS 258..597 CDD:281164 99/385 (26%)
SPAC227.01cNP_592955.2 EXS 15..351 CDD:281164 98/383 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.