DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and Xpr1

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_035403.1 Gene:Xpr1 MGIID:97932 Length:695 Species:Mus musculus

Alignment Length:696 Identity:381/697 (55%)
Similarity:480/697 (69%) Gaps:28/697 (4%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65
            ||||||||||||||||||||.||..|.|||.|.::|||||..::|.:||:||.|:|.||..|:||
Mouse     1 MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKE 65

  Fly    66 LKKINTFYSEKLAEATRKFATLNAELKTSIEESERSA--------KKSKGHKRH-AALPDRKARE 121
            |.|||||||||||||.|:||||..||::|::..:.|:        :|...|..| ..:..|..::
Mouse    66 LAKINTFYSEKLAEAQRRFATLQNELQSSLDVQKESSGVTTLRQRRKPVFHLSHEERVQHRNIKD 130

  Fly   122 LKLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNII 186
            ||||||||||||||||||||||.||||||||||||:|....||.||..:||.:.|:|.|.|:.:|
Mouse   131 LKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVIHVEVAPFYTCKKINQLI 195

  Fly   187 NETETTVTGELEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGSFIVLVIVVVVSAIFHEI 249
            :|||..||.|||.||||:||||||||||| .|.:| ||||:||||.|.||||.|.:|.:|:|...
Mouse   196 SETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVFAAVFKLE 260

  Fly   250 SGENLKVTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGV 314
            :...:....|:|||..|:|||:||:|:|.||||.:||||||||||:|||:||.|||.|:|...|:
Mouse   261 TDRTVWPLIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFLGI 325

  Fly   315 IWTLSMLSFLYSASLAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVG 379
            :|.||:|:..::....||.::.||.|...||.||.||....|:.:||||.::..|..:|||..||
Mouse   326 LWCLSLLACFFAPISIIPIYVYPLALYGFMVFFLINPTKTFYYKSRFWLLKLLFRVFTAPFHKVG 390

  Fly   380 FADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEAR--------DASICMEKDFIIRPIVNCLP 436
            ||||||.||||||:..::|.||:||||.....|.|::        :...|.:..:.:|.||.|:|
Mouse   391 FADFWLADQLNSLSVILMDLEYMICFYSFELKWDESKGLLPNDPQEPEFCHKYSYGVRAIVQCIP 455

  Fly   437 AWFRFAQCLRRYRDSREAFPHLVNAGKYSTTFMVVIFATLKSFH-SPNYASTFDNPYTWLWIIAS 500
            ||.||.||||||||:|.|||||||||||||||..|.||.|.|.| ..|::.|.  .:.:||:...
Mouse   456 AWLRFIQCLRRYRDTRRAFPHLVNAGKYSTTFFTVTFAALYSTHEEQNHSDTV--VFFYLWVFFC 518

  Fly   501 IVSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLT-EM 564
            |:||||...||:||||||||||||||||||||:||....:||.||:||:.|||.|.:...:| ..
Mouse   519 IISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITATF 583

  Fly   565 KIVSSDIMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILRLMDEA 629
            |....:|:.:|...|||||||||||||||||||||||:||||||||:|||::.||.|:.::||:.
Mouse   584 KPHVGNIIATVFAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQE 648

  Fly   630 DGVINRYTKANRPKPKKVKDPEKRSLLQTRGSLPDLRI---DMDSK 672
            |||.||  :.||..........:|..|.::....|.::   |.|.:
Mouse   649 DGVRNR--QKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDE 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 103/163 (63%)
SPX 3..158 CDD:281146 103/164 (63%)
EXS 258..597 CDD:281164 189/349 (54%)
Xpr1NP_035403.1 SPX_XPR1_like 2..165 CDD:269898 103/163 (63%)
SPX 3..169 CDD:281146 104/166 (63%)
Important for inositol polyphosphate binding. {ECO:0000250|UniProtKB:P43585} 158..165 7/7 (100%)
EXS 286..616 CDD:281164 179/332 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 744 1.000 Inparanoid score I582
Isobase 1 0.950 0.569298 Normalized mean entropy S1995
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T616836
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
1211.810

Return to query results.
Submit another query.