DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7536 and xpr1a

Sequence 1:NP_001285398.1 Gene:CG7536 FlyBaseID:FBgn0030890 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001232029.1 Gene:xpr1a ZFINID:ZDB-GENE-060503-362 Length:692 Species:Danio rerio

Alignment Length:696 Identity:381/697 (55%)
Similarity:483/697 (69%) Gaps:31/697 (4%)


  Fly     1 MKFAEHLSAHITPEWRKQYINYEEMKAMLYLAVEEAPSVESVEDDVLKRHFANFDENFFHYCDKE 65
            ||||||||||||||||||||.||..|.|||.|.::|||:|..::|.:||::|.|:|.||..|:||
Zfish     1 MKFAEHLSAHITPEWRKQYIQYEAFKEMLYAAQDQAPSLEVTDEDTVKRYYAKFEEKFFQTCEKE 65

  Fly    66 LKKINTFYSEKLAEATRKFATLNAELKTSIEESERSAKKSKGHKRHAALP--------DRKAREL 122
            |.|||||||||||||.|:||||..||:||::....|...:...:|...||        .|..::|
Zfish    66 LSKINTFYSEKLAEAQRRFATLQNELQTSLDAQRESNAPALRSRRKTVLPLSNKERNKHRNIKDL 130

  Fly   123 KLAFSEFYLSLILLQNYQNLNHTGFRKILKKHDKLLRVDTGAKWRQEYVEASHFFTNKDIDNIIN 187
            :||||||||||||||||||||.||||||||||||:|....||.||..:||.:.|:|.|.|..:|:
Zfish   131 QLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILDTPRGADWRVAHVEVAPFYTCKKITQLIS 195

  Fly   188 ETETTVTGELEGGDRQRAMKRLRVPPLG-EQQSP-WTTFKVGLFSGSFIVLVIVVVVSAIFHEIS 250
            |||..||.||||||||:||||||||||| .|.:| ||||:|||:.|.||||.:..|::..|. :.
Zfish   196 ETEALVTTELEGGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLYCGVFIVLAVAFVLTGAFF-VR 259

  Fly   251 GENLKVTFRLYRGPLLIIEFIFLIGVNIYGWRSSGVNHVLIFELDPRNHLSEQHLMELAAIFGVI 315
            .:|:....|:|||..|:::|:||:|:|.||||.:||||||||||:|||:||.|||.|:|...||:
Zfish   260 KQNIWPLVRIYRGGFLLVQFLFLLGINTYGWRQAGVNHVLIFELNPRNNLSHQHLFEIAGFLGVL 324

  Fly   316 WTLSMLSFLYSASLAIPAFINPLTLTLIMVLFLANPFHVLYHDARFWLWRITGRCVSAPFFHVGF 380
            |.||:||.|::....:|...|||.|...|:|||.|||...|:.:||||.::..|..:|||..|.|
Zfish   325 WCLSILSCLFADYTWLPMQANPLILYGFMLLFLINPFKTAYYKSRFWLIKLLFRVFTAPFHRVEF 389

  Fly   381 ADFWLGDQLNSLATAILDFEYLICFYFTNGNWTEARDASI--------CMEKDFIIRPIVNCLPA 437
            |||||.||||||...:.|.|||:|:|.....|.| |:..:        |....:.:|.|::||||
Zfish   390 ADFWLADQLNSLVIVLSDLEYLVCYYSMELQWGE-RNGLLPAKFGDERCNSFSYGVRAIIHCLPA 453

  Fly   438 WFRFAQCLRRYRDSREAFPHLVNAGKYSTTFMVVIFATLKSFH-SPNYASTFDNPYTWLWIIASI 501
            |.||.||||||||:|.|||||||||||||||.||.||.|...| ..|:|.:  ..:.::.:::||
Zfish   454 WLRFVQCLRRYRDTRRAFPHLVNAGKYSTTFFVVTFAALYRTHKDQNHADS--EVFFYMLVLSSI 516

  Fly   502 VSSCYAYTWDIKMDWGLFDKNAGENTFLREEVVYSSTGFYYFAILEDLALRFIWALSFYLTEMKI 566
            |||.|...||:||||||||:|||||||||||:||....:||.||:||:.|||.|.|...||.|..
Zfish   517 VSSLYTLIWDLKMDWGLFDRNAGENTFLREEIVYPHKAYYYCAIIEDVLLRFAWTLQISLTSMTR 581

  Fly   567 VSS--DIMTSVTGILEVFRRFVWNFFRLENEHLNNCGKFRAVRDISIAPLDSSDQALILRLMDEA 629
            :.|  ||:.::...|||||||||||||||||||||||:||||||||:|||::.||.|:.::||:.
Zfish   582 IPSIEDIVVTILAPLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQE 646

  Fly   630 DGVINRYTKANRPKPKKVKDPEKRSLLQTRGSLPDLRI---DMDSK 672
            |||.||..|.:..:...:.  .:|.||.:: |..|.::   |.|.:
Zfish   647 DGVRNRQGKKSWKRSYSLS--LRRPLLSSQ-SKKDTKVLIEDTDDE 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7536NP_001285398.1 SPX_XPR1_like 2..156 CDD:269898 101/162 (62%)
SPX 3..158 CDD:281146 101/163 (62%)
EXS 258..597 CDD:281164 191/350 (55%)
xpr1aNP_001232029.1 SPX_XPR1_like 2..164 CDD:269898 101/162 (62%)
SPX 3..169 CDD:281146 102/166 (61%)
EXS 284..614 CDD:281164 183/333 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5409
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D125160at33208
OrthoFinder 1 1.000 FOG0001323
OrthoInspector 1 1.000 T128810
orthoMCL 1 0.900 OOG5_127625
Panther 1 1.100 O PTHR10783
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1440
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.