DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG34459

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 / 5740101 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster


Alignment Length:211 Identity:84/211 - (39%)
Similarity:125/211 - (59%) Gaps:12/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DRDKDRNNIRDRDNCD---SCD--EII---NSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQA 151
            |..|..:|    ..||   .|:  .||   :.:.|::.||..|||.||||::||:||.|.|::..
  Fly    90 DNSKSASN----KQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAGQAAAQHI 150

  Fly   152 KMQLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAE 216
            ||:|||||..:|:||:|.|.|||.|||...:|:::|..||.:.|.|:.::|.|:.|:...||.|.
  Fly   151 KMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANMNAAVEAVKVAV 215

  Fly   217 VQAETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEA 281
            .|.||...|.:.....|:.:.::...|..::..|.|:|.||:.|...|.:|:..|..:||:.|:|
  Fly   216 QQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQA 280

  Fly   282 ACRAASAAVEAKQKVG 297
            |.:||.|||||||:.|
  Fly   281 AYKAACAAVEAKQRAG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 75/178 (42%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 75/179 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.