DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12985 and CG14354

Sequence 1:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster

Alignment Length:269 Identity:90/270 (33%)
Similarity:145/270 (54%) Gaps:37/270 (14%)


  Fly    84 WDRNRGCDRNRDRDKDRNNIRDRDNCDSCDEII-----NSRLKATHIAQNAAQVAKAANDAQAAA 143
            :.|:..|.:|  :.:.|:.:.|:    |.|..:     ||:..|::|||.|||.||.|:|.||.|
  Fly    28 YQRHSSCPQN--QQQSRSQLLDQ----SADLTMGIRQGNSKQTASNIAQKAAQEAKKASDTQAPA 86

  Fly   144 AQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEAS 208
            |..|:||.|.|||||||:||:||:|.|.|||.:::....|:.:||.:|.:.:.||..|:|||..:
  Fly    87 ALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNVA 151

  Fly   209 CAVVKAAEVQAETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKS 273
            .|..|..:...::.|:.|:.....:|..::....:..::.||||::..|:.|.:.|.:|:..||.
  Fly   152 VATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKNQLVETARQRAEMLMQQLRSAKL 216

  Fly   274 EYEQVKEAACRAASAAVEAKQKVGTGSLLYKSSVHRLPTVAIRANGARGYALDRNTCNALLDLYR 338
            :|...::||.|||.||.||:.|                  |:|  ..|.|..|      :...:.
  Fly   217 DYTNTRKAAYRAACAANEARNK------------------AVR--DRRSYEED------IGGTFG 255

  Fly   339 QRRRQQQRM 347
            |:::|||:|
  Fly   256 QQQQQQQQM 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 73/179 (41%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 73/198 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.