DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12985 and CG14839

Sequence 1:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster

Alignment Length:208 Identity:64/209 (31%)
Similarity:112/209 (54%) Gaps:13/209 (6%)


  Fly    89 GCDRNRDRDKDRNNIRDRDNCDSCDEIINSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKM 153
            |.|.|....|.||:             .|::.:::.||..||..||.|||....|.::|:.:.|.
  Fly    63 GEDSNSPAKKTRNH-------------TNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKG 114

  Fly   154 QLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQ 218
            :.|:||.:||:||:|||.||..:::....|:|:||.||.:.:..|..:|:|.:.:....:..:.:
  Fly   115 EYADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQE 179

  Fly   219 AETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAAC 283
            .:|....::....|....|.:.......:.:|..:|.||:.|.:.|.||:::|:.:|::.|:||.
  Fly   180 LKTLTISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAAL 244

  Fly   284 RAASAAVEAKQKV 296
            .||.||.||||::
  Fly   245 SAAKAAQEAKQRI 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 58/179 (32%)
CG14839NP_650351.2 DUF745 77..237 CDD:283087 47/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.