DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12985 and CG14839

DIOPT Version :9

Sequence 1:NP_573255.1 Gene:CG12985 / 32774 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650351.2 Gene:CG14839 / 41736 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster


Alignment Length:208 Identity:64/208 - (30%)
Similarity:112/208 - (53%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GCDRNRDRDKDRNNIRDRDNCDSCDEIINSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKM 153
            |.|.|....|.||:             .|::.:::.||..||..||.|||....|.::|:.:.|.
  Fly    63 GEDSNSPAKKTRNH-------------TNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKG 114

  Fly   154 QLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQ 218
            :.|:||.:||:||:|||.||..:::....|:|:||.||.:.:..|..:|:|.:.:....:..:.:
  Fly   115 EYADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQE 179

  Fly   219 AETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAAC 283
            .:|....::....|....|.:.......:.:|..:|.||:.|.:.|.||:::|:.:|::.|:||.
  Fly   180 LKTLTISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAAL 244

  Fly   284 RAASAAVEAKQKV 296
            .||.||.||||::
  Fly   245 SAAKAAQEAKQRI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 58/178 (33%)
CG14839NP_650351.2 DUF745 77..237 CDD:283087 46/159 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.