DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12985 and CG11698

Sequence 1:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster

Alignment Length:248 Identity:65/249 (26%)
Similarity:124/249 (50%) Gaps:32/249 (13%)


  Fly   100 RNNIRDRDNCDSCDEIINSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAAR 164
            ||:.|.:.....|    .:.:||:.:|..||:.||.|.|||..||:.|..:|:..||::|:.||:
  Fly    33 RNDPRFKPGSLPC----KTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAK 93

  Fly   165 AADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQ------AETFR 223
            ||:|.|.||:.::|.|.:.:.:...|:.::..::..|      ||:...|..::      ....:
  Fly    94 AAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAIAAS------SCSATSAKGIRDKLCTSVNIMK 152

  Fly   224 ALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASA 288
            :::::..|.|..:..:.|.:..:..||..:|.||:.|.:.|...:.:|:.:.|:.|::|.:|..|
  Fly   153 SMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDA 217

  Fly   289 AVEAKQKVGTGSLLYKSSVHRLPTVAIRANGARGYALDRNTCNALLDLYRQRR 341
            |.||:|::                .|::...:|...|.|....:|.:..|:||
  Fly   218 AKEAQQRI----------------EALQKLVSRIKMLKRKDLQSLENFLRRRR 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 53/185 (29%)
CG11698NP_649787.2 DUF745 45..225 CDD:283087 54/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.