DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12985 and CG11693

Sequence 1:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001246985.1 Gene:CG11693 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster

Alignment Length:188 Identity:53/189 (28%)
Similarity:90/189 (48%) Gaps:22/189 (12%)


  Fly   125 IAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEE 189
            ||:.:|..|.:|..:|.||.:.||..||..||:.|..||..|.|||:||:.::.....:..:|.:
  Fly   117 IAKGSADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHK 181

  Fly   190 VVGQVSCSLQNSETNVEAS----------CAVVKAAEVQAETFRALVQQ-TSGILSEMDSLIDQS 243
            .:......||.::.:.:|:          .:|:.||...|::...|.|: .|...:|:.|.||  
  Fly   182 AMENELTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQID-- 244

  Fly   244 NMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASAAVEAKQKVGTGSL 301
                     |:|.||.:.:....|...|:.:||:.::||.:|..:|.||.......:|
  Fly   245 ---------MVAQAKTKLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNANDAAL 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12985NP_573255.1 DUF745 117..296 CDD:283087 52/182 (29%)
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 52/182 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.