DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt7 and Supt7l

DIOPT Version :8

Sequence 1:NP_573248.2 Gene:Spt7 / 32766 FlyBaseID:FBgn0030874 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_082426.1 Gene:Supt7l / 72195 MGIID:1919445 Length:412 Species:Mus musculus

Alignment Length:357 Identity:70/357 - (19%)
Similarity:137/357 - (38%) Gaps:75/357 - (21%)


  Fly     5 HWGSLPAEDDGGQLTPDKY--VPTAAKKLKLDEIRQRGDP---QPQEKHHK----LELRS---AL 57
            :||.:|.  ..||.....:  :|   ::.:|.|:.   ||   ||.....|    |::.|   :|
Mouse     4 YWGEIPI--PSGQTNRSSFDLLP---REFRLVEVH---DPPLHQPSANKPKPPTMLDIPSEPCSL 60

  Fly    58 VTQTIEVMKQTEVLQSLIETYSNKN--------GSSNYLLNPCLMIPEV--DFPP-----ENAAE 107
            ...||::::....|:|||.|...::        ...:..|..|...|.:  |..|     .||..
Mouse    61 TIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPNAPF 125

  Fly   108 LVGSQKFQKPIWFTPTVDTAYSRGDPEAYPEIPSSACRQAMRKVMCGMLRLAGFTDCSESAVQLL 172
            .:   :...|       ::.:.||..|...|:...:|||.:.:.:..:|...||...:||.::.|
Mouse   126 QI---RHSDP-------ESDFYRGKGEPVTELSWHSCRQLLYQAVATILAHTGFECANESVLETL 180

  Fly   173 TDATEEFLRSFIGEYRGYYDSQPRLQNS---TVLQLVPLERAHFAQTGT-SLTQVHNYYKHKVLA 233
            ||...|:...|....|...|.:..|..:   .|::.|      |.:.|. |:..:..:::|::..
Mouse   181 TDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQV------FHEVGIGSVLSLQKFWQHRIKD 239

  Fly   234 RNRAEIAEFNSVLQEYDKLMKESQSSMQKQHNEFNGHDFLNILDNSATGSSQSIGGMAMGDMLQD 298
            .:...:.....:.:||::::...:::...:..:.....   :.|.:...|.:....:|.||    
Mouse   240 YHTYMLQISKQLSEEYERIVNPEKATEDTKPVKIKEEP---VSDITFPVSEELEADLASGD---- 297

  Fly   299 LGGSTGSSGTVSSQQMLYGLLDGQISSNTSNM 330
                         |.:..|:|..|.....||:
Mouse   298 -------------QSLPIGVLGAQSERFPSNL 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spt7NP_573248.2 None
Supt7lNP_082426.1 TAF9 149..224 CDD:304618 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007962
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28598
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.