DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt7 and supt7l

DIOPT Version :8

Sequence 1:NP_573248.2 Gene:Spt7 / 32766 FlyBaseID:FBgn0030874 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_989021.1 Gene:supt7l / 394617 XenbaseID:XB-GENE-945813 Length:412 Species:Xenopus tropicalis

Alignment Length:387 Identity:80/387 - (20%)
Similarity:139/387 - (35%) Gaps:107/387 - (27%)


  Fly     5 HWGSLPAEDDGGQLT------------------PDKYVPTAAKKLKLDEIRQRGDPQPQEKHHKL 51
            :||.:|.  ..||..                  |..:.|:|.|            |:|..   .|
 Frog     4 YWGEIPV--SSGQANRSSFDLLQREFRTVEMQEPPLHQPSANK------------PRPTT---ML 51

  Fly    52 ELRS---ALVTQTIEVMKQTEVLQSLIETYSNKN----------GSSNYLLNPCL-MIPEVDFPP 102
            ::.|   :|...||::::....|:.||.....:|          .|....|.|.. .:|| |..|
 Frog    52 DIPSEPCSLTIHTIQLIQHNRRLRGLIAGAQAQNQQQVEGMKVEESEPLPLRPTSPALPE-DLLP 115

  Fly   103 ENAAELVGSQKFQ----KPIWFTPTVDTAYSRGDPEAYPEIPSSACRQAMRKVMCGMLRLAGFTD 163
            ::..  |....||    .|       ::.:.||..|...|:...:|||.|.:.:..:|..|||..
 Frog   116 QDCK--VPKLPFQIRHSDP-------ESEFYRGKGEPVTELGYHSCRQLMYQSVATILAHAGFES 171

  Fly   164 CSESAVQLLTDATEEFLRSFIGEYRGYYDSQPRLQNSTVLQLVPLERA---HFAQTGT-SLTQVH 224
            .:||.::.|||...|:...|....|...|.:.||..:      |.:.|   .|.:.|. |:..:.
 Frog   172 ANESVLETLTDIAHEYCLKFTKMLRFNVDREARLGQT------PFQDAVEQVFHEMGIGSVLSLQ 230

  Fly   225 NYYKHKVLARNRAEIAEFNSVLQEYDKLMKESQSSMQKQHNEFNGHDF--LNILDNSATGSSQSI 287
            .:::.:        |.::::.:.:..|.:.|...::  .|.|....|.  :.|.:...|..:..|
 Frog   231 KFWQQR--------IKDYHTYMLQVSKQLSEEYENI--VHPERASEDTKPVKIKEEPLTDITFPI 285

  Fly   288 -----GGMAMGDMLQDLGGSTGSSGTVSSQQMLYGLLDGQISSNTSNMTGTSGNGSTGGNGN 344
                 |.:|.||                 |.:..|:|..|....::|:...|....:|.:.|
 Frog   286 NEELEGDLAPGD-----------------QSLPVGVLGAQSERFSANIEVDSSPQPSGSDVN 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spt7NP_573248.2 None
supt7lNP_989021.1 TAF9 149..223 CDD:328941 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007962
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.