DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and HB-2

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana

Alignment Length:205 Identity:53/206 (26%)
Similarity:75/206 (36%) Gaps:49/206 (24%)


  Fly   193 AAVASTVATIQHRLMIGNRQSLPPAGPPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEE 257
            |.|:|..:|:..  ..|.|........| :||.   |...|.|.|:|..|.|.|:.     |...
plant    87 AGVSSPNSTVSS--STGKRSEREEDTDP-QGSR---GISDDEDGDNSRKKLRLSKD-----QSAI 140

  Fly   258 LERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVR----------------------- 299
            ||..|......:...::|||.:|.|:..:|.||||||||:.:                       
plant   141 LEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLKQTEVDCEFLRRCCENLTEENR 205

  Fly   300 --KREHT-----KKGPGRPAHNAQPQT------CSGEPIPPNELKAKERARRRKKLAKAIDRQAR 351
              ::|.|     |..|....|.:.|.|      |....:||.:.:|...|..|.....|.....|
plant   206 RLQKEVTELRALKLSPQFYMHMSPPTTLTMCPSCEHVSVPPPQPQAATSAHHRSLPVNAWAPATR 270

  Fly   352 KLQAKGITVD 361
              .:.|:|.|
plant   271 --ISHGLTFD 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 19/53 (36%)
NK <327..>368 CDD:302627 9/36 (25%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:282474 6/22 (27%)
HOX 128..182 CDD:197696 21/59 (36%)
HALZ 184..227 CDD:128634 5/43 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
10.910

Return to query results.
Submit another query.