DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and repo

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster

Alignment Length:547 Identity:128/548 (23%)
Similarity:195/548 (36%) Gaps:177/548 (32%)


  Fly    53 SNSIPNAHRTNAGQHLLGGSPSSACSTSVSGCGMPSEGLHPTAALQLYAAAAQLAPNGVRVPPWG 117
            |:|..:.:.....|||.||||.     .:......|:||     ||   .::.:..||       
  Fly   173 SSSPKDQYEPQQLQHLYGGSPH-----HLDHLDHGSDGL-----LQ---DSSPVMING------- 217

  Fly   118 PFLQFGVPGVFGPNGPFLGRP-----RFDAASAGGHPNSAAAAAAATQMAAVNASNAFANLTGLS 177
                       |..|..|.:|     :.:|..||..|.|:::...          |...|.||.:
  Fly   218 -----------GSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVV----------NGTTNGTGNA 261

  Fly   178 AAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPPAGPPSEGSNEDGGFPGDGDDDSSAAK 242
                 |.|::....:...|.|...:          :.|.|......|.:.|        |.:..|
  Fly   262 -----NSSSSAGVGIQGAAGTAGGV----------AAPAAKKDGSSSKKKG--------DPNGIK 303

  Fly   243 RRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKK- 306
            ::::||.|.::|||||||||..:.|||:|.||.||::|:|.||||.|||||||||.||.|..:| 
  Fly   304 KKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKT 368

  Fly   307 -------------GPG--RPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAK 356
                         .||  .|...:.|||.:  ..||..:.:....:...:|......        
  Fly   369 GYIKTSTPPTATLNPGTLAPPFTSYPQTTT--VTPPGSMDSWTSYQTPYELTPQFSL-------- 423

  Fly   357 GITVDLEALKAEYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAV------------- 408
                 |....:.|       ||:|                      |...|.             
  Fly   424 -----LSPAASPY-------GTYS----------------------GQYGAYVHESQLFPMRHYE 454

  Fly   409 --SPVRLGGGGGGGGGTGGGGGGGASSSLHCGLDGDGDSSRAGSFIGGGGSLGSPS-SVAPPSML 470
              ||.|:..|...|                 .:.|:||.|     :..|||..:.. ..|....|
  Fly   455 YGSPTRMEMGATTG-----------------SVAGNGDES-----VANGGSYQTAELQTAQQQQL 497

  Fly   471 SNGAVQFGKLEPMDGNESEERDRERDSPKPLLFPAKAFHQLNLQSSQQHHGLVVGQGQGSGSGHG 535
            ::|.     |..:..::.:::.:::.:.|.|  .|:....::||..|...||.:..|   .|.|.
  Fly   498 ADGT-----LVTVHAHQQQQQQQQQLNGKYL--SAEEAKYVHLQCHQSGGGLELSPG---ASCHL 552

  Fly   536 HGHQHNHHQHHLHHGSASASAAAAVAN 562
            ...|..|:......|:|||...::..|
  Fly   553 VEAQGQHYVTTATGGAASAGGTSSDDN 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 35/53 (66%)
NK <327..>368 CDD:302627 3/41 (7%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124284214
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.