DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and Poxm

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster

Alignment Length:224 Identity:54/225 (24%)
Similarity:73/225 (32%) Gaps:71/225 (32%)


  Fly    17 NNNSSASRNNNSHNNNNNNHSPKEIPEETGRSSSTSSNSIPNAH-RTNAGQHLLGG--SPSSACS 78
            ||.:|||.|.|..|..|....|..........|:.::.|..:.| ..:|..||...  .|.||.:
  Fly   167 NNGTSASNNINLSNLGNPGGGPHHPHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAA 231

  Fly    79 --TSVSGCGMPSEGLHPTAALQLYAAAAQLAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFD 141
              :..:.||.||                         ||.|...|..||                
  Fly   232 AYSMKTPCGSPS-------------------------PPQGAGGQGSVP---------------- 255

  Fly   142 AASAGGHPNS----AAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATI 202
                  ||:.    |||||||...::.:.|:..|:   ..|.||| .|......|..:....:|:
  Fly   256 ------HPHQLRSVAAAAAAAHWPSSHSVSDILAH---HQAVALR-ASCQVGVGVGGMGGMGSTV 310

  Fly   203 QHRLMIGNRQSLPPAGPPSEGSNEDGGFP 231
                     ..||....|..|:  .||.|
  Fly   311 ---------SPLPMTPSPVAGT--AGGQP 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475
NK <327..>368 CDD:302627
PoxmNP_001036687.1 PAX 10..133 CDD:128645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124286759
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.