DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and gsb

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster

Alignment Length:148 Identity:53/149 (36%)
Similarity:81/149 (54%) Gaps:25/149 (17%)


  Fly   196 ASTVATIQHRLMIGNRQS--------LPPAGPPSEGSNEDGGFPGDGDDDSSAA-----KRRRSR 247
            |.:|::|. ||:.|:..|        :...|..|.||.:      :.:||:..:     |:||||
  Fly   132 APSVSSIS-RLLRGSSGSGTSHSIDGILGGGAGSVGSED------ESEDDAEPSVQLKRKQRRSR 189

  Fly   248 TNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKK----GP 308
            |.|::.|::.|||.|:.:.|||::.||.||....|.|:||.|||.||||::||:.:|::    .|
  Fly   190 TTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAP 254

  Fly   309 GRPAHNAQPQTCSGEPIP 326
            ...:..|.| |.|..|.|
  Fly   255 TSTSFGATP-TTSAAPAP 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 27/53 (51%)
NK <327..>368 CDD:302627 53/149 (36%)
gsbNP_523863.1 PAX 19..143 CDD:128645 5/12 (42%)
homeodomain 186..243 CDD:238039 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124280589
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.