powered by:
                  
 
    
 
    
             
          
            Protein Alignment unc-4 and gsb-n
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001285389.1 | 
            Gene: | unc-4 / 32757 | 
            FlyBaseID: | FBgn0024184 | 
            Length: | 588 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_523862.1 | 
            Gene: | gsb-n / 38004 | 
            FlyBaseID: | FBgn0001147 | 
            Length: | 449 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 112 | 
            Identity: | 48/112 - (42%) | 
          
          
            | Similarity: | 58/112 -  (51%) | 
            Gaps: | 28/112 - (25%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   217 AGPPSEGS-----------NEDG-------GFPGDGDDDSS----------AAKRRRSRTNFNSW 253 
            |.|||..|           :|||       |..|..|.|.|          ..|:|||||.|.:. 
  Fly   128 ADPPSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAE 192 
 
  Fly   254 QLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRK 300 
            |||.||||||.:.|||::.||.||....|.|:|:.|||.||||::|| 
  Fly   193 QLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRK 239 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            1 | 
            0.930 | 
            - | 
            - | 
             | 
            C45450915 | 
          
          
            | Domainoid | 
            1 | 
            1.000 | 
            55 | 
            1.000 | 
            Domainoid score | 
            I4097 | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            3 | 2.840 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.