DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-4 and gsb-n

DIOPT Version :9

Sequence 1:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:112 Identity:48/112 - (42%)
Similarity:58/112 - (51%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 AGPPSEGS-----------NEDG-------GFPGDGDDDSS----------AAKRRRSRTNFNSW 253
            |.|||..|           :|||       |..|..|.|.|          ..|:|||||.|.:.
  Fly   128 ADPPSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAE 192

  Fly   254 QLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRK 300
            |||.||||||.:.|||::.||.||....|.|:|:.|||.||||::||
  Fly   193 QLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 30/52 (58%)
NK <327..>368 CDD:302627
gsb-nNP_523862.1 PAX 20..141 CDD:278709 5/12 (42%)
Homeobox 185..238 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450915
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.