DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and Poxn

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001261016.1 Gene:Poxn FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster

Alignment Length:383 Identity:82/384 (21%)
Similarity:107/384 (28%) Gaps:133/384 (35%)


  Fly   141 DAASAGGHPNSAAAAAAATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHR 205
            :||:|      |||||||...|....||.:..........:...:.|.|.::|..|...|     
  Fly   145 NAAAA------AAAAAAAAHQAGSGPSNGYGGQAPPPPVTVAPPTPAATPSIARYAKPPA----- 198

  Fly   206 LMIGNRQSLP----PAGPPSEGSNEDGGFPGDGDDDSSAAKRRRSRTNFNSWQLEELERAFSASH 266
            ||:.:...:|    |..|||.|.....|.                  |.|   :..|:.::||.|
  Fly   199 LMMNSAGEMPIKPAPKMPPSMGHGHSHGL------------------NPN---VSGLDLSYSALH 242

  Fly   267 YPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPPNELK 331
                                 ..|..|.......:.|.:         ||.....|:.:|     
  Fly   243 ---------------------KHWLWNPSLLYYTQAHIQ---------AQAAASGGQFLP----- 272

  Fly   332 AKERARRRKKLAKAIDRQARKLQAKGITVDLEALKAEYISQHKANGTFSDS----DLEDDGIQID 392
                                  .|.|...  .|:.|...|...|.|.|:.|    ||...|...|
  Fly   273 ----------------------YAGGYLP--HAMAAAAASSTSALGGFTKSESSIDLSTPGAAGD 313

  Fly   393 VVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGGGGGGASSS------------------LHCGL 439
            .:...||.....: |:|....|||.|.|.......|...|.|                  |..  
  Fly   314 ALSDCDSGKSSPA-ALSLTASGGGNGAGSAPEASPGSTLSHSRKRNPYSIEELLKKPEKRLRL-- 375

  Fly   440 DGDGDSSRAGSFIGGGGSLGSPSSVAPPSMLSNGAVQFGKLEPMDGNESEERDRERDS 497
                ||:|..............|.||||         ....|..|..|:||...|.||
  Fly   376 ----DSNRLECLESSSCESSQDSPVAPP---------LETPEDEDPAEAEEEQEEEDS 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 8/53 (15%)
NK <327..>368 CDD:302627 4/41 (10%)
PoxnNP_001261016.1 HTH 5..133 CDD:304362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124281856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.