DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and eve

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster

Alignment Length:134 Identity:42/135 (31%)
Similarity:56/135 (41%) Gaps:13/135 (10%)


  Fly   207 MIGNRQSLPPAGPPSEG---SNEDGGFPGD-GDDDSSAAKRRRSRTNFNSWQLEELERAFSASHY 267
            ::..:...|...|||..   |:.|....|. |.:..:....||.||.|...||..||:.|...:|
  Fly    30 LLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENY 94

  Fly   268 PDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGP-----GRPAHNAQ----PQTCSGE 323
            .....|..||.:|:|.||.:.|||||||.|.:::......|     ..||..|.    .....|.
  Fly    95 VSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGM 159

  Fly   324 PIPP 327
            |.||
  Fly   160 PYPP 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 24/53 (45%)
NK <327..>368 CDD:302627 1/2 (50%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124282719
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.