DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and UNCX

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001073930.1 Gene:UNCX HGNCID:33194 Length:531 Species:Homo sapiens

Alignment Length:481 Identity:150/482 (31%)
Similarity:188/482 (39%) Gaps:166/482 (34%)


  Fly   118 PFLQFGVPGVFGPNGPFLGRP----RFDAASAGGHPNSAAAAAAATQMAAVNASNAFANLTGLSA 178
            |..|||     |..|..:|.|    ........||...:|||||:...          ::.||..
Human    10 PHAQFG-----GSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAASVPF----------SIDGLLG 59

  Fly   179 AALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQSLPPA-------GPPSEGSNEDGGFPGDGDD 236
            .           :.||.||.|          |...|.||       |.|.:.|:.     ||.|.
Human    60 G-----------SCAAAASVV----------NPTPLLPAACGVGGDGQPFKLSDS-----GDPDK 98

  Fly   237 DSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKR 301
            :|...||||:||||..|||||||:||:.|||||:|||||||:||||.||||.|||||||||.||:
Human    99 ESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKK 163

  Fly   302 EHTKKGPGRPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEALK 366
            |:|||||||||||:.|.||||||:.|.|:..||..:..||..|    ..:||             
Human   164 ENTKKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRK----HEKKL------------- 211

  Fly   367 AEYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGGGGGGA 431
                             |:..|..:...||.                                  
Human   212 -----------------LKSQGRHLHSPGGL---------------------------------- 225

  Fly   432 SSSLHCGLDGDGDSSRAGSFIGGGGSLGSPSSVAPPSMLSNGAVQFGKLEPMDGNESEERDRERD 496
              |||.....|.||       ||||....|....||:....||...|.     ...:.....|..
Human   226 --SLHSAPSSDSDS-------GGGGLSPEPPEPPPPAAKGPGAHASGA-----AGTAPAPPGEPP 276

  Fly   497 SP---KPLLFPAKAFHQLNLQSSQQHHGLVVGQGQGSGSGHGHGHQHNHHQHHLHHGSASASAAA 558
            :|   .|..:|:                    |..|:|.....|...:       ..:||....|
Human   277 APGTCDPAFYPS--------------------QRSGAGPQPRPGRPAD-------KDAASCGPGA 314

  Fly   559 AVANLVHQTSPISMRRSNPFSIESLL 584
            |||.:  :.....:.:::|||:||||
Human   315 AVAAV--ERGAAGLPKASPFSVESLL 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 42/53 (79%)
NK <327..>368 CDD:302627 9/41 (22%)
UNCXNP_001073930.1 Homeobox 108..161 CDD:306543 42/53 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BD9D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004834
OrthoInspector 1 1.000 T608705
orthoMCL 1 0.900 OOG5_134700
Panther 1 1.100 LDO PTHR46799
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.