DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and Gsc

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster

Alignment Length:412 Identity:110/413 (27%)
Similarity:164/413 (40%) Gaps:117/413 (28%)


  Fly    30 NNNNNNHSPKEIPEETGRSSSTSSNSIPNAHRTNAGQHLLGGSPSSACSTSVSG--CGMPSEGL- 91
            ::::.:.|...|.||..|..:.:::.........:.|...|.:||.....|.:|  .|:.|.|: 
  Fly   138 SSDDGSQSGVTILEEERRGGAAAASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGIS 202

  Fly    92 ------------HPTAALQLYAAAAQLAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFDAAS 144
                        .|.:.....|||:.:.|.  |||   ..||.  ||:.                
  Fly   203 LGLKRSGAESPASPNSNSSSSAAASPIRPQ--RVP---AMLQH--PGLH---------------- 244

  Fly   145 AGGHPNSAAAAAAATQMAA------VNASNAFANLTGLSAAALRNVSAAQTTA-VAAVASTVATI 202
             .||    .|||||:..||      |...|.:.|.  :.|||:.:|:|||..| |:..|:.::  
  Fly   245 -LGH----LAAAAASGFAASPSDFLVAYPNFYPNY--MHAAAVAHVAAAQMQAHVSGAAAGLS-- 300

  Fly   203 QHRLMIGNRQSLPPAGP--PSEGSNEDG----GFPGDGDDDSSAAKRRRSRTNFNSWQLEELERA 261
            .|    |:....|...|  |..|::..|    ...|.|....   ::||.||.|...|||:||..
  Fly   301 GH----GHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPK---RKRRHRTIFTEEQLEQLEAT 358

  Fly   262 FSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIP 326
            |..:||||:.:||.||:::||||.||.|||:|||||.||:                         
  Fly   359 FDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ------------------------- 398

  Fly   327 PNELKAKERARRRKKLAKAIDRQARKLQAK--GITVDLEALKAEYISQHKANGTFSDSDLEDD-- 387
                |.:|:.|            .||||.:  |.|.:.....:...:....||:.:......|  
  Fly   399 ----KREEQER------------LRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHY 447

  Fly   388 -----GIQIDVVGGTDSDDEGD 404
                 .|:.|..|.:|:|:..|
  Fly   448 SAQLVHIKSDPNGYSDADESSD 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 31/53 (58%)
NK <327..>368 CDD:302627 9/43 (21%)
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124289090
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.