DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and OdsH

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster

Alignment Length:341 Identity:145/342 (42%)
Similarity:191/342 (56%) Gaps:66/342 (19%)


  Fly    92 HPTAALQLYAAAAQLAPNGVRVPPWGPFLQFGVPGVFGPNGPFLGRPRFDAASAGGHPNSAAAAA 156
            |.::|||||||||.:   .::|..|...|...:                ||.:....|||     
  Fly    22 HGSSALQLYAAAAAV---NMQVSGWSSVLNLSM----------------DAPNPEISPNS----- 62

  Fly   157 AATQMAAVNASNAFANLTGLSAAALRNVSAAQTTAVAAVASTVATIQHRLMIGNRQ--------- 212
                  ..|:|:.:         .:|.::..|...|||.|..:...|.:....||:         
  Fly    63 ------VTNSSSVY---------MIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQ 112

  Fly   213 -----SLPPAGPPSEGS---------NEDGGFPGDGDDD-SSAAKRRRSRTNFNSWQLEELERAF 262
                 |:.|......||         :::|.....|.:| :.::|:||.|||||||||.||||.|
  Fly   113 RIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVF 177

  Fly   263 SASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPP 327
            ..|||||||||||||.:|||.|.|:||||||||||.||:||||||||||||||.||:|||:|||.
  Fly   178 QGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPL 242

  Fly   328 NELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEALKAEYISQHKANGTFSDSDLEDDG---I 389
            :||:|:|.|:|.|::.|||||||:|||.||:.||...|:|||::.|:.||...::.|:|||   :
  Fly   243 SELRARELAQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEYLAAHQENGVDENNWLDDDGYDDL 307

  Fly   390 QIDVVGGTDSDDEGDS 405
            .|||||.......|||
  Fly   308 HIDVVGVEPEYVTGDS 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 42/53 (79%)
NK <327..>368 CDD:302627 23/41 (56%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BD9D
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004834
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46799
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.