DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: unc-4 and Vsx2

Sequence 1:NP_001285389.1 Gene:unc-4 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster

Alignment Length:555 Identity:135/556 (24%)
Similarity:172/556 (31%) Gaps:224/556 (40%)


  Fly   151 SAAAAAAATQMAAVNASNAFANLTGLS-------------------------------AAALRNV 184
            :.||.:|||.....||  |..|||.:|                               |||.|  
  Fly    53 ATAATSAATAATPTNA--AEGNLTSVSEPQQQPQQQQQEQQHHQPHHHQYREHHQMTMAAASR-- 113

  Fly   185 SAAQTTAVAAVASTVATIQHRL-------------------------MIGNRQSLPPAGPPSE-- 222
             .|...|.||||:  |.:.|:|                         .:|.    ||..||.:  
  Fly   114 -MAYFNAHAAVAA--AFMPHQLAAAVHHHHQHQHQHHPHHHPHHPHGAVGG----PPPPPPMQHH 171

  Fly   223 --------------------------------------GSNEDGGFPGDGDDDSSAAKRRRSRTN 249
                                                  |.....||....:......|||.|||.
  Fly   172 HPHHPHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTI 236

  Fly   250 FNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVRKREHTKKGPGRPAHN 314
            |.|:|||:||.||..:||||::.||.|:::.:|.|.|:.|||||||||.||.|....|       
  Fly   237 FTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGG------- 294

  Fly   315 AQPQTCSGE------------PIPPNELKAKERARRRKKLAKAIDRQARKLQAKGITVDLEALKA 367
               .|...|            |:|...||:          ||..|..|..|           |..
  Fly   295 ---STIMAEYGLYGAMVRHSLPLPDTILKS----------AKDNDAVAPWL-----------LGM 335

  Fly   368 EYISQHKANGTFSDSDLEDDGIQIDVVGGTDSDDEGDSDAVSPVRLGGGGGGGGGTGGGGGGGAS 432
            |....|: ....:.|.|:||.      |.:|.:|                           ...|
  Fly   336 EQKCMHR-KSIEAQSALKDDS------GVSDHED---------------------------SAGS 366

  Fly   433 SSLHCGLDGDGDSSRAGSFIGGGGSLG-----------SPSSVAPPSMLSN--GAVQFGKLEPMD 484
            .|.|   ..|...||..:......||.           |.|:.|||:..|.  ||.......|..
  Fly   367 KSAH---SEDLSRSRCHALSSSTESLNVVSPAPSSCPTSASTSAPPTSTSGYAGAASSAATTPTG 428

  Fly   485 G---NESEERDRERDSPKPLLFPAKAFHQLNLQSSQQHH-GLVVGQGQ--------------GSG 531
            .   |.|.....|..||.|     :....|.||..||.. .|.:|.|.              .:.
  Fly   429 ASTTNSSSSPHIELGSPSP-----QQQQHLQLQQQQQQQASLYLGAGAVVTGCAPPSYHPLLDAA 488

  Fly   532 SGHGHGHQHNHHQHHLHHGSASASAAAAVANLVHQ 566
            :..|.|...:....|:...:|.|:|||| |...||
  Fly   489 NAAGAGAAASSKDFHMIMNTAVAAAAAA-AQQQHQ 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475 31/53 (58%)
NK <327..>368 CDD:302627 8/41 (20%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 31/53 (58%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124287431
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.