DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and TVP38

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_013014.3 Gene:TVP38 / 853963 SGDID:S000001796 Length:337 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:55/277 - (19%)
Similarity:105/277 - (37%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TPQKQAMSADEKKATK------------KSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKI 116
            :|:::.|....|...|            :.::::.||.   |:.|..:..:|.  ||...:.:..
Yeast    67 SPRERLMHNIRKNVQKLQFYFYSLRLWQQIIIVLLGIM---LMIMGILLLVFH--NAILHKVVVT 126

  Fly   117 PRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLIC 181
            ..|:::......:|    .:..|.|.|..::.|..|.|..       .::.|..::..:.|    
Yeast   127 SNDLREKMSTHFIL----MVLIFFVAFPPMIGYSLLSTTT-------GLIYGVSFEGWVTL---- 176

  Fly   182 FCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSL-----FNYMLFLRMTPILPNW 241
               ||| ::..::::.|..:.|.|...:|....::..|.....|     :..:..||:.| .|..
Yeast   177 ---ALG-SVTGSIASFVVFKTILHSRAEKLVHLNRRFEALASILQENNSYWILALLRLCP-FPYS 236

  Fly   242 FINLA-SPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSS----SEAFSWTSMGILMACA 301
            ..|.| :.|.|:.:..|::.... ..|...|.:..|..::.:..|    |..|...|  |::...
Yeast   237 LTNGAIAGVYGISVRNFSIANII-TTPKLFIYLFIGSRVKSLAESESTGSRVFDLVS--IIITLL 298

  Fly   302 CASLLPGLLKNKFKHKK 318
            ..||...||  .||.||
Yeast   299 ILSLTAWLL--YFKTKK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 22/124 (18%)
TVP38NP_013014.3 DUF5828 <27..>59 CDD:408916
TVP38 83..322 CDD:223475 51/261 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.