DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and AT1G71940

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001185376.1 Gene:AT1G71940 AraportID:AT1G71940 Length:306 Species:Arabidopsis thaliana

Alignment Length:228 Identity:83/229 (36%)
Similarity:128/229 (56%) Gaps:3/229 (1%)


  Fly    64 TPQKQAMSADEKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAK 128
            :|..:....|....::..|.:..|:|:.....:|.:|...|   |:|...||:||.:.|.::|..
plant    22 SPSGKRSKLDRFPLSRWELAVSLGVFLVFSSGLCCIYMTMP---AAEFGKLKLPRSLADLRLLKD 83

  Fly   129 VLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYT 193
            .|..|.:.|..:.:.|....|:|:|||.|||::|:|:|.|.|:.....:.|:.|.:..|||.|:.
plant    84 NLANYANEYPAQFVLGYCATYIFMQTFMIPGTIFMSLLAGALFGVFKGVVLVVFNATAGATSCFF 148

  Fly   194 LSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFA 258
            ||.|:||.||...||.|...:...:.:.||.|.|||||||:||.|||.|||||||::.||.|:|.
plant   149 LSKLIGRPLITWLWPDKLRFFQAEISKRRDKLLNYMLFLRITPTLPNLFINLASPIVDVPFHVFF 213

  Fly   259 LGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSW 291
            |.|..|:.|.:.|.::||..:..:.|..:.:.:
plant   214 LATLIGLIPAAYITVRAGLAIGDLKSVKDLYDF 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 56/119 (47%)
AT1G71940NP_001185376.1 TVP38 74..239 CDD:223475 68/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1490
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125087
orthoMCL 1 0.900 OOG5_128091
Panther 1 1.100 O PTHR43220
Phylome 1 0.910 0.731 Consistency score
76.970

Return to query results.
Submit another query.