DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stas and AT4G09580

Sequence 1:NP_573225.1 Gene:stas FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_192696.3 Gene:AT4G09580 AraportID:AT4G09580 Length:287 Species:Arabidopsis thaliana

Alignment Length:274 Identity:94/275 (34%)
Similarity:144/275 (52%) Gaps:8/275 (3%)


  Fly    48 DLNPQQQQQQQQQQQATPQKQAMSADEK---KATKK-----SLVIVAGIFVASLVTMCYVYAIFP 104
            |...:|..:.::...|:...:.:..|:.   |.||.     |....|..|...||....::.|:.
plant    10 DGGARQLVKDEESPAASSAAKGLLNDDSPTGKRTKSERFPLSRWEFAVFFTVFLVFTTGLFCIYL 74

  Fly   105 ELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGF 169
            .:.|:|...||:||.|.|.::|.:.|..|...|....:.|....|:|:|||.|||::|:|:|.|.
plant    75 TMPAAEYGKLKVPRTISDLRLLKENLGSYASEYQARFILGYCSTYIFMQTFMIPGTIFMSLLAGA 139

  Fly   170 LYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRM 234
            |:.......|:...:..||..|:.||.||||.|:...||:|...:...:.:.||.|.|||||||:
plant   140 LFGVVRGFVLVVLNATAGACSCFFLSKLVGRPLVNWLWPEKLRFFQAEIAKRRDRLLNYMLFLRI 204

  Fly   235 TPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMA 299
            ||.|||.||||:||::.:|.|:|.|.|..|:.|.|.|.::||..|..:.|..:.:.:.::.:|..
plant   205 TPTLPNLFINLSSPIVDIPFHVFFLATLVGLMPASYITVRAGLALGDLRSVKDLYDFKTLSVLFL 269

  Fly   300 CACASLLPGLLKNK 313
            ....|:.|.|||.|
plant   270 IGSISIFPALLKRK 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 53/119 (45%)
AT4G09580NP_192696.3 TVP38 104..284 CDD:223475 70/181 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1490
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125087
orthoMCL 1 0.900 OOG5_128091
Panther 1 1.100 O PTHR43220
Phylome 1 0.910 0.720 Consistency score
76.970

Return to query results.
Submit another query.