| Sequence 1: | NP_573225.1 | Gene: | stas / 32737 | FlyBaseID: | FBgn0030850 | Length: | 320 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017449188.1 | Gene: | Tmem64 / 689176 | RGDID: | 1596128 | Length: | 388 | Species: | Rattus norvegicus |
| Alignment Length: | 207 | Identity: | 44/207 - (21%) |
|---|---|---|---|
| Similarity: | 83/207 - (40%) | Gaps: | 45/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 92 SLVTMCYVYAI-FPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTF 155
Fly 156 AIP---GSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKH 217
Fly 218 VEEYRDSL------------FNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSV 270
Fly 271 IAIQAGKTLQKM 282 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| stas | NP_573225.1 | SNARE_assoc | 157..276 | CDD:286425 | 24/133 (18%) |
| Tmem64 | XP_017449188.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0398 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||